INSERT INTO sites(host) VALUES('') 1045: Access denied for user 'www-data'@'localhost' (using password: NO) Estimated Worth $473,871 - MYIP.NET Website Information
Welcome to!
 Set MYIP as homepage      


Web Page Information

Meta Description:
Meta Keywords:
sponsored links:
sponsored links:

Traffic and Estimation


Website Ranks

Alexa Rank:
Google Page Rank:
Sogou Rank:
Baidu Cache:

Search Engine Indexed

Search EngineIndexedLinks

Server Data

Web Server:
IP address:    

Registry information

ICANN Registrar:
Name Server:
Whois Server:

Alexa Rank and trends

Traffic: Today One Week Avg. Three Mon. Avg.
Unique IP:

More ranks in the world

Users from these countries/regions

Where people go on this site

Alexa Charts

Alexa Reach and Rank

Whois data

Who is at

Domain Name: XIXTUBE.COM

Registry Domain ID: 1514753768_DOMAIN_COM-VRSN

Registrar WHOIS Server:

Registrar URL:

Updated Date: 2016-04-02T12:22:46Z

Creation Date: 2008-08-18T23:19:02Z

Registry Expiry Date: 2018-08-18T23:19:02Z

Registrar: eNom, Inc.

Registrar IANA ID: 48

Registrar Abuse Contact Email:

Registrar Abuse Contact Phone:

Domain Status: clientTransferProhibited

Name Server:

Name Server:

DNSSEC: unsigned

URL of the ICANN Whois Inaccuracy Complaint Form:

>>> Last update of whois database: 2017-08-30T01:52:26Z <<<

For more information on Whois status codes, please visit

The expiration date displayed in this record is the date the

registrar's sponsorship of the domain name registration in the registry is

currently set to expire. This date does not necessarily reflect the expiration

date of the domain name registrant's agreement with the sponsoring

registrar. Users may consult the sponsoring registrar's Whois database to

view the registrar's reported date of expiration for this registration.

You are not authorized to access or query our Whois

database through the use of electronic processes that are high-volume and

automated except as reasonably necessary to register domain names or

modify existing registrations; the Data in VeriSign Global Registry

Services' ("VeriSign") Whois database is provided by VeriSign for

information purposes only, and to assist persons in obtaining information

about or related to a domain name registration record. VeriSign does not

guarantee its accuracy. By submitting a Whois query, you agree to abide

by the following terms of use: You agree that you may use this Data only

for lawful purposes and that under no circumstances will you use this Data

(1) allow, enable, or otherwise support the transmission of mass

unsolicited, commercial advertising or solicitations via e-mail, telephone,

or facsimile; or (2) enable high volume, automated, electronic processes

that apply to VeriSign (or its computer systems). The compilation,

repackaging, dissemination or other use of this Data is expressly

prohibited without the prior written consent of VeriSign. You agree not to

use electronic processes that are automated and high-volume to access or

query the Whois database except as reasonably necessary to register

domain names or modify existing registrations. VeriSign reserves the right

to restrict your access to the Whois database in its sole discretion to ensure

operational stability. VeriSign may restrict or terminate your access to the

Whois database for failure to abide by these terms of use. VeriSign

reserves the right to modify these terms at any time.

The Registry database contains ONLY .COM, .NET, .EDU domains and


Front Page Thumbnail

sponsored links:

Front Page Loading Time

Keyword Hits (Biger,better)

Other TLDs of xixtube

TLDs Created Expires Registered

Similar Websites


Search Engine Spider Emulation

Title:Xix Tube Sex Videos and Free Adult Porn Movies
Description:Xix Tube Sex Videos is the most popular sex tube on the net right now! You will know why this is the best streaming xxx videos website straight away as it has the biggest and sexiest collection of hot full HD porn clips with the wildest action possible!
Keywords:xix tube, sex tube, free sex, hot girls, sexy girls, free porn, free sex photos, free sex movies, free sex video, free porn photos, free porn movies, free porn video, free xxx
Xix Tube Sex Videos and Free Adult Porn Movies
Here you won't be seeing any sort of free sex videos, only the hottest ones and the wildest ones that will leave you wanting more and more as the quality is fucking sensational! Not only is all of the action really hot here, there are so many hot porn niches here that you will definitley find whatever you're looking for!
Home Page
-any date-TodayYesterday2 days ago3 days ago4 days ago5 days ago6 days agoLast WeekWeek Ago
-any len-0..5 minutes5..20 minutes20..40 minutes40..60 minutes60..90 minutes gt; 90 minutes
-any tube-aShemaleTubebigXvideosDrTuberHardsextubeHDpornNuvidOverThumbsPornerBrosPornHubRedTubeSunPornoTube8VID2CXhamsterXVideosXXXKinKyYobtYouPorn
694498 Teen Sex Videos
358515 Mature Sex Videos
2843 Forced Sex Videos
104957 Japanese Sex Videos
56846 Wife Sex Videos
352299 Anal Sex Videos
Old Young
28418 Old Young Sex Videos
723302 Amateur Sex Videos
3498 Story Sex Videos
35141 Vintage Sex Videos
13644 Indian Sex Videos
18 Year Old
23033 18 Year Old Sex Videos
Monster Cock
10681 Monster Cock Sex Videos
40078 Jizz Sex Videos
17725 Housewife Sex Videos
54547 Orgasm Sex Videos
202119 Lesbian Sex Videos
21866 Casting Sex Videos
Mature Amateur
95684 Mature Amateur Sex Videos
26155 German Sex Videos
1999 Sleeping Sex Videos
66664 Russian Sex Videos
55860 Massage Sex Videos
Hidden Cam
34482 Hidden Cam Sex Videos
Cum In Mouth
20515 Cum In Mouth Sex Videos
Plump Teen
4253 Plump Teen Sex Videos
183402 Milf Sex Videos
Old Man
8359 Old Man Sex Videos
105140 Shemale Sex Videos
17322 Seduce Sex Videos
4143 Bus Sex Videos
Big Cock
253409 Big Cock Sex Videos
71596 Party Sex Videos
111026 Hairy Sex Videos
69058 Creampie Sex Videos
365226 Masturbating Sex Videos
363318 Pussy Sex Videos
15908 French Sex Videos
3401 Retro Sex Videos
21551 Slave Sex Videos
149071 Interracial Sex Videos
19946 Perverted Sex Videos
3354 Pain Sex Videos
38195 Gangbang Sex Videos
10924 Swinger Sex Videos
5404 Maid Sex Videos
222555 Asian Sex Videos
181713 Public Sex Videos
18915 Compilation Sex Videos
10823 Game Sex Videos
118170 Webcam Sex Videos
93946 Handjob Sex Videos
9768 Classic Sex Videos
Old Young Lesbian
2571 Old Young Lesbian Sex Videos
255337 Gay Sex Videos
8691 Doctor Sex Videos
5577 Husband Sex Videos
2421 Surprise Sex Videos
150004 Bdsm Sex Videos
11138 Beach Sex Videos
1069626 Blowjob Sex Videos
451498 Babe Sex Videos
Home Made
80980 Home Made Sex Videos
27711 Cuckold Sex Videos
1215 Ugly Sex Videos
753416 Hardcore Sex Videos
Lesbian Teen
52122 Lesbian Teen Sex Videos
Anal Creampie
20575 Anal Creampie Sex Videos
12128 Anime Sex Videos
126599 Tranny Sex Videos
24354 Chubby Sex Videos
Barely Legal
19009 Barely Legal Sex Videos
5213 Oldy Sex Videos
Old Farts
1925 Old Farts Sex Videos
45009 Jerking Sex Videos
15643 Teacher Sex Videos
8158 Cash Sex Videos
30796 Panties Sex Videos
25301 Bizarre Sex Videos
12362 Czech Sex Videos
9301 Italian Sex Videos
6801 Thai Sex Videos
1597 Rocco Sex Videos
18383 Nudist Sex Videos
10729 Spy Sex Videos
145502 Bbw Sex Videos
21105 Squirt Sex Videos
8038 Arabian Sex Videos
2029 Filipina Sex Videos
723604 Fucking Sex Videos
Group Sex
271474 Group Sex Sex Videos
146042 3some Sex Videos
109156 Voyeur Sex Videos
18928 British Sex Videos
11775 African Sex Videos
11215 Animation Sex Videos
9188 Chinese Sex Videos
5773 Cheating Sex Videos
1964 Exploited Sex Videos
86934 Outdoor Sex Videos
Strap On
59109 Strap On Sex Videos
Small Cock
21334 Small Cock Sex Videos
16056 Office Sex Videos
Saggy Tits
1072 Saggy Tits Sex Videos
205298 Couple Sex Videos
200323 Cumshot Sex Videos
109259 Beauty Sex Videos
75472 Stockings Sex Videos
22852 Fisting Sex Videos
14577 Car Sex Videos
19 Year Old
11526 19 Year Old Sex Videos
9281 Kitchen Sex Videos
Mature Teacher
3073 Mature Teacher Sex Videos
718 Nun Sex Videos
390 Cinema Sex Videos
150 Hermaphrodite Sex Videos
Nipple Slip
97 Nipple Slip Sex Videos
211746 Cum Sex Videos
134411 Solo Sex Videos
76678 Reality Sex Videos
54328 Adorable Sex Videos
27506 Bisexual Sex Videos
249 Farting Sex Videos
417326 Girl Sex Videos
166420 Black Sex Videos
Mature Lesbian
38690 Mature Lesbian Sex Videos
37636 Femdom Sex Videos
33017 Asshole Sex Videos
Natural Boobs
13405 Natural Boobs Sex Videos
3663 Turkish Sex Videos
10+ Inch Cock
1788 10+ Inch Cock Sex Videos
1072 Midget Sex Videos
549 Pakistani Sex Videos
520626 Tits Sex Videos
195637 Ebony Sex Videos
127792 Busty Sex Videos
49502 Student Sex Videos
42066 Fat Sex Videos
Anal Toying
34358 Anal Toying Sex Videos
14500 Brazilian Sex Videos
13055 Uniform Sex Videos
10010 Nurse Sex Videos
Fat Mature
8017 Fat Mature Sex Videos
Big Nipples
7292 Big Nipples Sex Videos
5718 Korean Sex Videos
5308 Secretary Sex Videos
3421 Mexican Sex Videos
2852 Forest Sex Videos
2562 Hospital Sex Videos
777 Jail Sex Videos
446 Indonesian Sex Videos
563085 Sex Sex Videos
294426 Ass Sex Videos
129814 Pornstar Sex Videos
68591 Twink Sex Videos
60103 Wild Sex Videos
Big Black Cock
42827 Big Black Cock Sex Videos
34261 Kinky Sex Videos
32617 Perky Sex Videos
Big Natural Tits
18310 Big Natural Tits Sex Videos
16973 Tgirl Sex Videos
Fat Teen
15051 Fat Teen Sex Videos
15033 Juggs Sex Videos
6031 Milk Sex Videos
687 Caning Sex Videos
637 Country Sex Videos
572 Egyptian Sex Videos
458 Stewardess Sex Videos
349027 Blonde Sex Videos
Big Ass
116607 Big Ass Sex Videos
103069 Latina Sex Videos
62572 Butt Sex Videos
10527 Melons Sex Videos
9382 Gym Sex Videos
Monster Tits
7477 Monster Tits Sex Videos
4780 American Sex Videos
1691 Cameltoe Sex Videos
645 Hogtied Sex Videos
84449 Hd Sex Videos
Big Tits
408358 Big Tits Sex Videos
-any date-TodayYesterday2 days ago3 days ago4 days ago5 days ago6 days agoLast WeekWeek Ago
-any len-0..5 minutes5..20 minutes20..40 minutes40..60 minutes60..90 minutes gt; 90 minutes
-any tube-aShemaleTubebigXvideosDrTuberHardsextubeHDpornNuvidOverThumbsPornerBrosPornHubRedTubeSunPornoTube8VID2CXhamsterXVideosXXXKinKyYobtYouPorn
-all ages-18 year old19 year olddadgrannyinnocentmaturemilfmommothernunschoolgirlsisterteenuniversityvirginyoung
-all countries-africanamericanargentinianbrazilianbritishchinesecubanczechdutchegyptianfilipinafinnishfrenchgermangreekhawaiianindianindonesianitalianjapanesekoreanmexicanpakistanipolishrussianspanishswedishthaiturkish
Today top searches
. Arab black
. Arabic ass
. Asian busty school
. Bblack
. Big tits sister
. Breast milk
. Brother sister handjob
. Brutal teen
. Busty ebony
. Casting barely legal
. Cheating pussy lick
. Dog girls
. Elite spanking
. Faces of pain
. Fat wife
. First tine
. Forced outdoor
. Forced upskirt
. Free download sex
. Gay prostate
. Gay sport
. German mom
. German mom blowjob
. German mom son
. German office
. Harry potter
. Hidden beach
. Incezt
. Indian 18
. Indian college girls
. Japanes incest
. Mature lesson
. Mom fuck daughter
. Mom massage
. Mom son friend
. Sri lanka
. Sri lanka sex
. Sri lankan
. Tiny anal
. Young old hidden

Free Sex Videos
Today top tube Pornstars listing
. Alexis Redd
. Alina Li
. Alona
. Alonna Red
. Alysia
. Andrew Andretti
. Bed With Eva
. Buffy Davis
. Codi Bryant
. Crissy
. Danielle Ftv
. Emmy
. Geridcgurl
. Hendi
. Irina
. Jenni Loveitt
. Keri Windsor
. Kitti
. Leona Dulce
. Letizia
. Luissa Rosso
. Madison Parker
. Maica Hase
. Mallory Rae Murphy
. Marco
. Marisa
. Mila Beth
. Mira
. Pamela
. Petra Koloman
. Python
. Roberta Sligen
. Sahara Knight
. Sally
. Stacy Moran

Free Pornstar Videos
Top List of Porn Tube Sites
01. Video One
02. Sexy Fuck Tube
03. Adult Tube Porn
04. Xxx Sex Anal
05. DT Video
06. Sfico
07. Japan Xxx Movies
08. Pink Dino
09. Mature Tube Porn
10. Xxx Fuck Porn
11. Hot Milf Clips
12. Mag Post
13. Mom Porn Sex
14. Free Xxx Cam
15. Free Sex Videos
16. Brown Xxx Tube
17. White Porn Tube
18. Stream Sex Videos
19. Milf Fuck
20. Oral Sex Movies
21. Hq Sex Tubes
22. Hot Fuck Films
23. Xxx Sex Videos
24. Free Tube Xxx
25. Hard Porn
26. Beeg Porn Tube
27. Xvideos Porn
28. Mom Tube Sex
29. Fuck Tube Sex
30. Best Hd Sex
31. Hard Porn
32. Massage Xxx Movies
33. Asian Mom Porn
34. Maid Tube Sex
35. World Xxx Tube
36. Plumper Xxx Videos
37. Matures Fuck Tube
38. Mom Video Porn
39. Hardsextube Porn
40. Free Mobile Sex
41. Granny Porn Videos
42. Hard Bdsm Movies
43. Mature Hd Sex
44. Milf Hd Videos
45. Tubes Sex Clips
46. Hairy Porn Tube
47. Anal Sex Tube
48. Wow Fuck Tube
49. U Xxx Tube
50. Sex Tube Videos
51. Pornhub
52. Free Sex Tube
53. Paris Tube Porn
54. Best Sex Tube
55. Xxx Sex Fuck
56. Xhamster Porn
57. Homemade Xxx Videos
58. Long Xxx Videos
59. Sexy Porn Tuber
60. Hq Japanese Fuck
61. Iphone Porn
62. Stream Fuck
63. All Fuck Tube
64. Voyeur Porno Movies
65. Porno Hard
66. Grow Porn Videos
67. Squirt Porno Tubes
68. Free Redtube Porn
69. Free Xxx Tube
70. Great Porn Videos
71. Hairy Porno Tube
72. Fuck Milf Porn
73. Try Porn Tube
74. Free Facial
75. Right Porn Tube
76. 69 Tube Porn
77. X Xxx Tubes
78. Pussy Free Porn
79. Gangbang Movies Porn
80. Xxx Online Porn
81. Anal Xxx Tube
82. Mobile Tube Xxx
83. Xxx Tube Videos
84. Moms Xxx Movies/
85. Phone Porn Movies
86. All Sex Videos
87. Hd Free Porn
88. Fuck Tube Movies
89. Sex Porn Tube
90. Mobile Tube Porn
91. Free Housewife Porn
92. Free Ass Moms
93. Slut Wife Sex
94. Free Milf Sex
95. Milf Pornos
96. Wife Porno Movies
97. I Free Porn
98. Xhamster
99. Free Sex Party
100. Hardsextube
Xix Porn Tube is a kind of search engine that automatically generates sex tube videos. We'd like to emphasize that we don't shoot content you may find on this website. Our script auto generates links with porn movies and thumbs and adds them to the list on our website.
| Webmasters
| Buy Traffic
| Sell Traffic
| Abuse
| XiX Tube
| Searches Catalog

Updated Time

Friend links: ProxyFire    More...
Site Map 1 2 3 4 5 6 7 8 9 10 20 30 40 50 60 70 80 90 100 110 120 130 140 150 160 170 180 190 200 250 300 350 400 450 500 550 600 610 620 630 640 650 660 670 680 690 700 710 720 730 740 750
TOS | Contact us
© 2009 Dev by MYIP Elapsed:59.268ms