INSERT INTO sites(host) VALUES('') 1045: Access denied for user 'www-data'@'localhost' (using password: NO) Estimated Worth $224,323 - MYIP.NET Website Information
Welcome to!
 Set MYIP as homepage      


Web Page Information

Meta Description:
Meta Keywords:
sponsored links:
sponsored links:

Traffic and Estimation


Website Ranks

Alexa Rank:
Google Page Rank:
Sogou Rank:
Baidu Cache:

Search Engine Indexed

Search EngineIndexedLinks

Server Data

Web Server:
IP address:    

Registry information

ICANN Registrar:
Name Server:
Whois Server:

Alexa Rank and trends

Traffic: Today One Week Avg. Three Mon. Avg.
Unique IP:

More ranks in the world

Users from these countries/regions

Where people go on this site

Alexa Charts

Alexa Reach and Rank

Whois data

Who is at

# Copyright (c) 1997- IIS (The Internet Foundation In Sweden).

# All rights reserved.

# The information obtained through searches, or otherwise, is protected

# by the Swedish Copyright Act (1960:729) and international conventions.

# It is also subject to database protection according to the Swedish

# Copyright Act.

# Any use of this material to target advertising or

# similar activities is forbidden and will be prosecuted.

# If any of the information below is transferred to a third

# party, it must be done in its entirety. This server must

# not be used as a backend for a search engine.

# Result of search for registered domain names under

# the .se top level domain.

# This whois printout is printed with UTF-8 encoding.


state: active


holder: jenkpi6667-00001

admin-c: -

tech-c: -

billing-c: -

created: 1995-06-24

modified: 2015-11-01

expires: 2016-12-31

transferred: 2010-01-25



dnssec: unsigned delegation

status: ok

registrar: Loopia AB

Front Page Thumbnail

sponsored links:

Front Page Loading Time

Keyword Hits (Biger,better)

Other TLDs of koping

TLDs Created Expires Registered

Similar Websites


Search Engine Spider Emulation

Title: Köpings kommun
K #246;pings kommun
Visa webbversion
Hoppa till huvudinnehållet
Hoppa till sekundärt innehåll
A- #214;
L #228;ttl #228;st
Hitta till K #246;ping
Om webbplatsen
F #246;r anst #228;llda
Close [X]
Use Bing to translate the web site. We take no responsibility for the accuracy of the translation.
Translate webpage
Select languageafrikaansalbanianarabicbelarusianbulgariancatalanchinesechinese simplifiedchinese traditionalcroatianczechdanishdutchenglishestonianfilipinofinnishfrenchgaliciangermangreekhaitian creolehebrewhindihungarianicelandicindonesianirishitalianjapanesekoreanlatvianlithuanianmacedonianmalaymaltesenorwegianpersianpolishportugueseportuguese portugalromanianrussianserbianslovakslovenianspanishswahiliswedishtagalogthaiturkishukrainianvietnamesewelshyiddish
Köping websites in other languages
Barn amp; utbildning
Boende, miljö amp; trafik
Stöd amp; omsorg
Uppleva amp; göra
Kommun amp; politik
#8801; Meny
En vattenläcka är hittad i Kolsva
Vi har nu hittat en vattenläcka på Ekvägen i Kolsva och börjar arbetet med att laga den så snart som möjligt.
Stort tack till alla FRG:are för insatsen
Köpings kommun, genom kommunchef Olle Emanuelsson, riktar ett stort tack till Frivilliga resursgruppen (FRG) för deras insats i samband med vattenläckan 18 januari. FRG gjorde ett fantastiskt jobb där de stöttade kommunens personal i arbetet med att förse invånarna med dricksvatten.
Isiga vägar ställer till problem för sophämtarna
Soptömningen på vissa ställen på landsbygden kan bli försenad på grund av isiga och hala vägar. Om din tunna blir full går det bra att ställa extrasäckar bredvid tunnan.
Hjälp oss stödja våra barn och ungdomar med funktionsnedsättning!
Vi behöver kontaktpersoner, avlösare och stödfamiljer till barn och ungdomar med funktionsnedsättning. Det är enkla och trevliga uppdrag och du behöver inga andra kvalifikationer än din personliga lämplighet. Du får även betalt. Läs vidare här och tipsa gärna en kompis om det inte passar just dig!
Nu öppnar KomTek
I tisdags invigdes KomTek ‚Äď v√•r kommunala teknik och entrepren√∂rsskola. Nu p√• m√•ndag den 25 januari kommer de f√∂rsta klasserna f√∂r att arbeta praktiskt med teknik.
En del av √Ėstan√•sgatan √§r avst√§ngd p√• grund av vattenl√§cka
Publicerat: 1 februari 13.01
Vi ställer ut nödvatten i Kolsva - uppdaterad 13:22
Publicerat: 29 januari 08.29
Lötgatan stängs delvis av 1-12 februari
Publicerat: 28 januari 11.00
Nödvattnet i Munktorp finns kvar under dagen
Publicerat: 27 januari 07.47
Vattenläckan i Munktorp lagad - uppdaterad 18.50
Publicerat: 26 januari 16.24
Vattenledningarna spolas ur för att få bort missfärgningar
Publicerat: 25 januari 08.18
RSS Nyheter
Fler nyheter
Sagostund på Bibblan
Köpings stadsbibliotek
4 februari 10.00
Språkcafé i Kolsva
Kolsva bibliotek
4 februari 15.00
Läxhjälp på biblioteket
Köpings stadsbibliotek
4 februari 16.00
√Ėppet hus med sl√§ktforskning
Brukskyrkan, Kolsva
4 februari 17.00
√Ėrjan Lindvalls kvartett och Lina Adolphson
Kolsva bibliotek
4 februari 19.00
En skön revy
√Ėgir Mat Musik
5 februari 18.00
Vernissage - Lena Fransson och Birgitta Aivinzi
6 februari 11.00
RSS Kalender
Fler evenemang
Sök på webbplatsen
Gå direkt till
Gå direkt till
Fråga partierna
Idrottsanläggningar och lokaler
Lediga jobb
Tillstånd, regler och tillsyn
Flytta till Köping
Kontakta oss
Kontakta oss
Köpings kommun
0221-250 00
Fax: 0221-251 31
Besöksadress: Rådhuset, Stora torget
Postadress: Köpings kommun731 85 Köping
Måndag-torsdag: 8.00-17.00Fredag: 8.00-16.00Lunchstängt: 12.00-13.00
Lediga jobb
Hitta bostad
Tjänster på webben
Snabbfakta om
Köping - miljöcertifierad kommun
Sedan 2012 är Köpings kommuns organisation miljöcertifierad enligt standarden ISO 14 001. Köping är en av de första kommunerna med miljöcertifikat för alla förvaltningar och bolag. Köping producerar också fjärrvärme med fossilfria bränslen och stora investeringar görs i fastigheterna för att spara miljön och förbättra klimatet.
Läs mer om Köpings kommuns miljöarbete
Flytta till Köping
Tre goda argument för att flytta till Köping
En enklare vardag; n√§ra till f√∂rskola, skola, aff√§rer och fritidsanl√§ggningar.Mer f√∂r pengarna; behagligt l√•ga priser p√• hus och rimliga kommunala taxor. Centralt l√§ge i M√§lardalen; pendelavst√•nd till V√§ster√•s, Eskilstuna och √Ėrebro.
Läs mer om Köpings fördelar
Besök Köping
I Köpings kommun möter Mälarlandskapet Bergslagens skogrika marker. Stadens centrum med vackra sekelskifteshus runt Stora torget, åpromenaden, parkerna och hamnen ger Köping dess karaktär. Shoppa i stadens affärer eller varför inte ta en paus på ett mysigt café.
I Gamla stan finns Köpings museum med apoteksavdelningen Scheeles minne. Sommartid finns fler intressanta museer öppna längs Museistråket, bland annat Bil amp; teknikhistoriska samlingarna med världsunika bilar. Flera av våra museer öppnar även på vintern för förbokade grupper.
Läs mer om vad Köping kan erbjuda dig som besökare.
De första människorna bosätter sig i Köpingstrakten omkring 2 000 f Kr. Från den tiden, visar hällristningar vid bland annat Häljesta, att sjöfarten var tidigt utvecklad i regionen.
Köping nämns första gången år 1257 under namnet Laglösaköping, vilket visar att orten ännu inte blivit stad. Köpingssigillet är känt från 1349 och 1474 fick Köping stadsrättigheter.Läs mer om Köpings spännande historia.
Köping - miljöcertifierad kommun
Flytta till Köping
Besök Köping
K #246;ping - milj #246;certifierad kommun
Sedan 2012 är Köpings kommuns organisation miljöcertifierad enligt standarden ISO 14 001. Köping är en av de första kommunerna med miljöcertifikat för alla förvaltningar och bolag. Köping producerar också fjärrvärme med fossilfria bränslen och stora investeringar görs i fastigheterna för att spara miljön och förbättra klimatet.
Läs mer om Köpings kommuns miljöarbete
2010 K #246;pings kommun | 731 85 K #246;ping | Organisationsnr: 212000-2114 telefon 0221-250 00 | E-post:
Sök på webbplatsen
Barn utbildning
Boende, miljö trafik
Stöd omsorg
Uppleva göra
Kommun politik
A- #214;
L #228;ttl #228;st
Hitta till K #246;ping
Om webbplatsen
F #246;r anst #228;llda

Updated Time

Friend links: ProxyFire    More...
Site Map 1 2 3 4 5 6 7 8 9 10 20 30 40 50 60 70 80 90 100 110 120 130 140 150 160 170 180 190 200 250 300 350 400 450 500 550 600 610 620 630 640 650 660 670 680 690 700 710 720 730 740 750
TOS | Contact us
© 2009 Dev by MYIP Elapsed:83.355ms