INSERT INTO sites(host) VALUES('kinkygonzo.com') 1045: Access denied for user 'www-data'@'localhost' (using password: NO) kinkygonzo.com Estimated Worth $346,960 - MYIP.NET Website Information
Welcome to MyIP.net!
 Set MYIP as homepage      

  
           

Web Page Information

Title:
Meta Description:
Meta Keywords:
sponsored links:
Links:
Images:
Age:
sponsored links:

Traffic and Estimation

Traffic:
Estimation:

Website Ranks

Alexa Rank:
Google Page Rank:
Sogou Rank:
Baidu Cache:

Search Engine Indexed

Search EngineIndexedLinks
 Google:
 Bing:
 Yahoo!:
 Baidu:
 Sogou:
 Youdao:
 Soso:

Server Data

Web Server:
IP address:    
Location:

Registry information

Registrant:
Email:
ICANN Registrar:
Created:
Updated:
Expires:
Status:
Name Server:
Whois Server:

Alexa Rank and trends

Traffic: Today One Week Avg. Three Mon. Avg.
Rank:
PV:
Unique IP:

More ranks in the world

Users from these countries/regions

Where people go on this site

Alexa Charts

Alexa Reach and Rank

Whois data

Who is kinkygonzo.com at whois.evonames.com



Domain Name:
KINKYGONZO.COM

Registry Domain ID:

Registrar WHOIS Server: whois.evonames.com

Registrar URL: https://evonames.com/

Updated Date: 2017-03-13 07:40:00.985097

Creation Date: 2008-09-01

Registrar Registration Expiration Date: 2018-09-01

Registrar: EVOPLUS LTD

Registrar IANA ID: 1418

Registrar Abuse Contact Email: abuse

Registrar Abuse Contact Phone: +1.5144959001

Reseller: AHnames.com https://www.AHnames.com/

Domain Status: clientUpdateProhibited

Domain Status: clientDeleteProhibited

Domain Status: clientTransferProhibited

Registry Registrant ID: MI_6222906N

Registrant Name: Mires Titek

Registrant Organization:

Registrant Street: 4 Rue Forest apt. 27

Registrant City: Paris

Registrant State/Province:

Registrant Postal Code: 75018

Registrant Country: France

Registrant Phone: +33.970730215

Registrant Phone Ext:

Registrant Fax:

Registrant Fax Ext:

Registrant Email: info@oxotube.com

Registry Admin ID: MI_6222906N

Admin Name: Mires Titek

Admin Organization:

Admin Street: 4 Rue Forest apt. 27

Admin City: Paris

Admin State/Province:

Admin Postal Code: 75018

Admin Country: France

Admin Phone: +33.970730215

Admin Phone Ext:

Admin Fax:

Admin Fax Ext:

Admin Email: info@oxotube.com

Registry Tech ID: MI_6222906N

Tech Name: Mires Titek

Tech Organization:

Tech Street: 4 Rue Forest apt. 27

Tech City: Paris

Tech State/Province:

Tech Postal Code: 75018

Tech Country: France

Tech Phone: +33.970730215

Tech Phone Ext:

Tech Fax:

Tech Fax Ext:

Tech Email: info@oxotube.com

Registry Billing ID: MI_6222906N

Billing Name: Mires Titek

Billing Organization:

Billing Street: 4 Rue Forest apt. 27

Billing City: Paris

Billing State/Province:

Billing Postal Code: 75018

Billing Country: France

Billing Phone: +33.970730215

Billing Phone Ext:

Billing Fax:

Billing Fax Ext:

Billing Email: info@oxotube.com

Name Server: ns1.oxotube.com

Name Server: ns2.oxotube.com

DNSSEC: unsigned

URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/

>>> Last update of WHOIS database: 2017-03-13 07:43:11 <<<



Abuse email:
abuse@ahnames.com

Front Page Thumbnail

sponsored links:

Front Page Loading Time

Keyword Hits (Biger,better)

Other TLDs of kinkygonzo

TLDs Created Expires Registered
.com
.net
.org
.cn
.com.cn
.asia
.mobi

Similar Websites

More...
Alexa鏍囬

Search Engine Spider Emulation

Title:Kinky Gonzo Tube : Free Porn Videos : Private Sex Movies : XXX Anal and Big Tits Show
Description:Kinky Gonzo is the newest porn tube that is fully dedicated to high-quality free porn videos. We've done much work to gather only the most exciting exclusive sex movies and xxx videos from all over the Net to add them to our frequently updated porn archive!
Keywords:kinky gonzo, sex tube, porn tube, free porn, anal videos, amateur fuck, hardcore clips, xhamster, pornhub, asian films
Body:
Kinky Gonzo Tube : Free Porn Videos : Private Sex Movies : XXX Anal and Big Tits Show
Kinky Gonzo Tube is the newest porn tube that is fully dedicated to high-quality free porn videos. We've done much work to gather only the most exciting exclusive amateur movies and anal xvideos from all over the Net to add them to our frequently updated xxx archive! You won't find here sex movies you've already seen on dozens of other porn tubes. Only the freshest high-quality sex videos for free. You shouldn't pay for porn anymore!
Date
-any date-Yesterday2 days ago3 days ago4 days ago5 days agoLast Week6 days agoWeek Ago
Dur
-any len-0..5 minutes5..20 minutes20..40 minutes40..60 minutes60..90 minutes gt; 90 minutes
Tube
-any tube-aShemaleTubebigXvideosDrTuberHardsextubeHDpornOverThumbsPornerBrosPornHubRedTubeSunPornoTube8VID2CXhamsterXVideosXXXKinKyYobtYouPorn
Age
-all ages-18 year old19 year olddadgrannyinnocentmaturemilfmommothernunschoolgirlsisterteenuniversityvirginyoung
Country
-all countries-africanamericanargentinianbrazilianbritishchinesecubanczechdutchegyptianfilipinafinnishfrenchgermangreekhawaiianindianindonesianitalianjapanesekoreanmexicanpakistanipolishrussianspanishswedishthaiturkish
Teen
687992 Teen Tube Videos
Forced
2833 Forced Tube Videos
Story
3480 Story Tube Videos
Monster Cock
10592 Monster Cock Tube Videos
Indian
13556 Indian Tube Videos
Babe
445136 Babe Tube Videos
Milf
181161 Milf Tube Videos
Old Young
28204 Old Young Tube Videos
Sleeping
1980 Sleeping Tube Videos
Anal
349021 Anal Tube Videos
Mature
354630 Mature Tube Videos
Ass
290720 Ass Tube Videos
Japanese
102107 Japanese Tube Videos
Classic
9739 Classic Tube Videos
Big Natural Tits
17975 Big Natural Tits Tube Videos
Housewife
17587 Housewife Tube Videos
Wife
56148 Wife Tube Videos
Compilation
18826 Compilation Tube Videos
Big Black Cock
42676 Big Black Cock Tube Videos
Mature Teacher
3033 Mature Teacher Tube Videos
Doctor
8622 Doctor Tube Videos
Shemale
104860 Shemale Tube Videos
Orgasm
54270 Orgasm Tube Videos
Teacher
15492 Teacher Tube Videos
Gangbang
37794 Gangbang Tube Videos
Massage
55537 Massage Tube Videos
18 Year Old
22924 18 Year Old Tube Videos
Pakistani
546 Pakistani Tube Videos
Bus
4085 Bus Tube Videos
Old Man
8331 Old Man Tube Videos
Italian
9172 Italian Tube Videos
Vintage
34899 Vintage Tube Videos
Lesbian
199959 Lesbian Tube Videos
Public
179899 Public Tube Videos
Latina
102473 Latina Tube Videos
Swinger
10846 Swinger Tube Videos
Office
15971 Office Tube Videos
Casting
21764 Casting Tube Videos
German
25842 German Tube Videos
Maid
5351 Maid Tube Videos
Party
71476 Party Tube Videos
Cumshot
196595 Cumshot Tube Videos
Big Ass
116115 Big Ass Tube Videos
Cheating
5679 Cheating Tube Videos
Egyptian
554 Egyptian Tube Videos
Black
165609 Black Tube Videos
Nurse
9931 Nurse Tube Videos
Interracial
147742 Interracial Tube Videos
Old Farts
1925 Old Farts Tube Videos
Perverted
19887 Perverted Tube Videos
Mature Amateur
93963 Mature Amateur Tube Videos
Spy
10660 Spy Tube Videos
Bdsm
148999 Bdsm Tube Videos
Arabian
7923 Arabian Tube Videos
American
4718 American Tube Videos
Surprise
2411 Surprise Tube Videos
Nun
707 Nun Tube Videos
Seduce
17225 Seduce Tube Videos
Couple
205038 Couple Tube Videos
Cash
8120 Cash Tube Videos
Asian
217663 Asian Tube Videos
3some
144806 3some Tube Videos
Cameltoe
1676 Cameltoe Tube Videos
Handjob
92828 Handjob Tube Videos
Group Sex
269623 Group Sex Tube Videos
Hairy
110234 Hairy Tube Videos
Creampie
68617 Creampie Tube Videos
Hidden Cam
34244 Hidden Cam Tube Videos
Gym
9356 Gym Tube Videos
Cuckold
27441 Cuckold Tube Videos
Bbw
144354 Bbw Tube Videos
Beauty
108531 Beauty Tube Videos
Secretary
5228 Secretary Tube Videos
Ebony
194688 Ebony Tube Videos
Anime
11862 Anime Tube Videos
Gay
253433 Gay Tube Videos
Tranny
126289 Tranny Tube Videos
Brazilian
14375 Brazilian Tube Videos
Monster Tits
7458 Monster Tits Tube Videos
Strap On
58795 Strap On Tube Videos
Voyeur
108087 Voyeur Tube Videos
Outdoor
85689 Outdoor Tube Videos
Home Made
80565 Home Made Tube Videos
Kinky
34105 Kinky Tube Videos
Fisting
22313 Fisting Tube Videos
Big Tits
405596 Big Tits Tube Videos
Masturbating
361308 Masturbating Tube Videos
Russian
66088 Russian Tube Videos
Deepthroat
40812 Deepthroat Tube Videos
Bizarre
25068 Bizarre Tube Videos
Slave
21443 Slave Tube Videos
Fat Teen
14897 Fat Teen Tube Videos
Amateur
713185 Amateur Tube Videos
Panties
30574 Panties Tube Videos
Anal Creampie
20461 Anal Creampie Tube Videos
Midget
1071 Midget Tube Videos
Perky
32596 Perky Tube Videos
Rocco
1586 Rocco Tube Videos
Pornstar
128709 Pornstar Tube Videos
Orgy
47390 Orgy Tube Videos
Mature Lesbian
38442 Mature Lesbian Tube Videos
Flasher
28387 Flasher Tube Videos
Cum Swallowing
20277 Cum Swallowing Tube Videos
19 Year Old
11503 19 Year Old Tube Videos
10+ Inch Cock
1784 10+ Inch Cock Tube Videos
Lesbian Teen
51267 Lesbian Teen Tube Videos
French
15695 French Tube Videos
Game
10756 Game Tube Videos
Kitchen
9235 Kitchen Tube Videos
Chinese
8997 Chinese Tube Videos
Thai
6753 Thai Tube Videos
Fucking
719582 Fucking Tube Videos
Jerking
44878 Jerking Tube Videos
Chubby
24230 Chubby Tube Videos
Cum In Mouth
20385 Cum In Mouth Tube Videos
British
18776 British Tube Videos
Husband
5528 Husband Tube Videos
Farm
656 Farm Tube Videos
Student
49348 Student Tube Videos
Bisexual
27433 Bisexual Tube Videos
Pain
3341 Pain Tube Videos
Cinema
387 Cinema Tube Videos
Czech
12200 Czech Tube Videos
Boss
5975 Boss Tube Videos
Mmf
5028 Mmf Tube Videos
Turkish
3612 Turkish Tube Videos
Blowjob
1060038 Blowjob Tube Videos
Big Cock
252612 Big Cock Tube Videos
Busty
127099 Busty Tube Videos
Reality
75866 Reality Tube Videos
Stockings
74878 Stockings Tube Videos
Squirt
20879 Squirt Tube Videos
Natural Boobs
13199 Natural Boobs Tube Videos
Old Young Lesbian
2562 Old Young Lesbian Tube Videos
Filipina
2008 Filipina Tube Videos
Hermaphrodite
146 Hermaphrodite Tube Videos
Sex
561308 Sex Tube Videos
Pussy
361685 Pussy Tube Videos
Cum
210797 Cum Tube Videos
Hd
80726 Hd Tube Videos
Small Cock
21224 Small Cock Tube Videos
Barely Legal
19009 Barely Legal Tube Videos
Car
14485 Car Tube Videos
Prostitute
14366 Prostitute Tube Videos
Beach
11023 Beach Tube Videos
Mexican
3370 Mexican Tube Videos
Retro
3363 Retro Tube Videos
Swedish
2797 Swedish Tube Videos
Ugly
1185 Ugly Tube Videos
Indonesian
434 Indonesian Tube Videos
Solo
133747 Solo Tube Videos
Webcam
117194 Webcam Tube Videos
Mistress
24311 Mistress Tube Videos
Nudist
18279 Nudist Tube Videos
Nipples
17001 Nipples Tube Videos
Upskirt
14790 Upskirt Tube Videos
Crossdressing
11775 Crossdressing Tube Videos
Rimjob
11316 Rimjob Tube Videos
Melons
10504 Melons Tube Videos
Fat Mature
7892 Fat Mature Tube Videos
Polish
1770 Polish Tube Videos
Prostate
1118 Prostate Tube Videos
Army
811 Army Tube Videos
Enema
676 Enema Tube Videos
Hardcore
744424 Hardcore Tube Videos
Blonde
345673 Blonde Tube Videos
Fat
41726 Fat Tube Videos
Femdom
37349 Femdom Tube Videos
Crazy
21515 Crazy Tube Videos
African
11717 African Tube Videos
Milk
5984 Milk Tube Videos
Korean
5668 Korean Tube Videos
Greek
550 Greek Tube Videos
Mardi Gras
108 Mardi Gras Tube Videos
Tits
517312 Tits Tube Videos
Girl
415356 Girl Tube Videos
Oldy
5207 Oldy Tube Videos
Feminization
1913 Feminization Tube Videos
Saggy Tits
1042 Saggy Tits Tube Videos
Pantyhose
18704 Pantyhose Tube Videos
Date
-any date-Yesterday2 days ago3 days ago4 days ago5 days agoLast Week6 days agoWeek Ago
Dur
-any len-0..5 minutes5..20 minutes20..40 minutes40..60 minutes60..90 minutes gt; 90 minutes
Tube
-any tube-aShemaleTubebigXvideosDrTuberHardsextubeHDpornOverThumbsPornerBrosPornHubRedTubeSunPornoTube8VID2CXhamsterXVideosXXXKinKyYobtYouPorn
Age
-all ages-18 year old19 year olddadgrannyinnocentmaturemilfmommothernunschoolgirlsisterteenuniversityvirginyoung
Country
-all countries-africanamericanargentinianbrazilianbritishchinesecubanczechdutchegyptianfilipinafinnishfrenchgermangreekhawaiianindianindonesianitalianjapanesekoreanmexicanpakistanipolishrussianspanishswedishthaiturkish
Today top searches
Search
. 21sextury
. Ass inspection
. Austrian
. Babe movies
. Big black cock pov
. Brother sister blowjob
. Double asian
. Extrem brutality black dick
. Family doctor
. Faye reagan gangbang
. Femdom wrestling
. Group sex amateur mature
. Holly sampson
. Horny jap wife
. Kinky piss
. Latex machine
. Lolitas nudes
. Massage czech
. Milf anal hd
. Pain punish
. Red tube
. Retro maid
. Rocco hairy
. Secret camera sex
. Seduce lesbian
. Sucking
. Teacher student japanese
. Teen spanish
. Very young looking teenie
. Vinam
. Voyeur japanese
. Wanda tai
. Watersport lesbian
. Webcam kiss
. Wecam
. Wife anal cuckold bbc
. Wife girlfriend
. Wife husbands friend
. Young chubby teen
. Young man older woman

Free Porn Videos
Today top tube Pornstars listing
Search
A
B
C
D
E
F
G
H
I
J
K
L
M
N
O
P
Q
R
S
T
U
V
W
X
Y
Z
. Brandi Love
. Britney Manson
. Camryn Kiss
. Conner Bradley
. Coral Aorta
. Dee Rose
. Evila
. Holly Halston
. Jade Indica
. Jamey James
. Jinni Lewis
. Jordan James
. Kari Gold
. Karma
. Krista Allen
. Laura Honey
. Macy Lane
. Melanie Silver
. Michaels
. Minogue
. Nikki Hunter
. Nolan
. Petra
. Petty
. Sadie Say
. Sara Nakamura
. Sayra Von
. Skye Sinn
. Stella Hot
. Taina Lousada
. Tay Dash
. Topanga
. Tori Mayes
. Ulrika
. Vyxen Steel

A
B
C
D
E
F
G
H
I
J
K
L
M
N
O
P
Q
R
S
T
U
V
W
X
Y
Z
Free Pornstar Videos
Top List of Porn Tube Sites
1-40
01 Xxx Sex Anal
02 Latin Tube Porn
03 Free Xxx Clips
04 X Hamster Hq
05 Free Fuck Tube
06 24x7 Porn Tube
07 41 XXX Tube
08 Stream ViD
09 Sexy Xxx Babes
10 Xxx Tube List
11 Free Xxx Movies
12 Video One
13 Free Classic Porn
14 Free Moms Sex
15 DT Video
16 69 Tube Porn
17 Mrs Sex Tube
18 Hq Porn Tubes
19 Mature Videos Porn
20 Paris Tube Porn
21 Fuck Tube Movies
22 Beez Tube
23 Tube Porno Videos
24 Sex Tube Videos
25 Oral Sex Movies
26 Dino Tube
27 Bbw Fuck Videos
28 Beeg Porn Tube
29 Fuck Anal Tube
30 Gangbang Sex Tube
31 Free Xxx Cam
32 Mom Tube Sex
33 Beeg Tube
34 Xhamster
35 Moms Fuck
36 World Xxx Tube
37 Redtube Porn
38 Free Porn Tubes
39 White Porn Tube
40 Grow Porn Videos
41-80
41 Massage Xxx Movies
42 Mommy Porn Videos
43 Fresh Asian Porn
44 Hd Sex Tubes
45 Free Sex Porn
46 Group Fuck Movies
47 Mature Sex Clips
48 Amateur Tube Porn
49 Mobile Xxx Porn
50 Free Squirt Porno
51 Free Sex Videos
52 Granny Xxx Films
53 Free Ebony Clips
54 Latina Fuck Tube
55 African Xxx Movies
56 Granny Porn Videos
57 Hardsextube
58 Free Boobs Porn
59 Anal Xxx Tube
60 Xxx Videos
61 Best Sex Tube
62 Sex Tube Sun
63 Free Sex Tube
64 Movs Porn Tube
65 All Fuck Tube
66 Sex Tube Club
67 Porn Tube Movies
68 My Xxx Movies
69 XaX Tube
70 Hard Porn
71 Arion Porn Movies
72 Hard Amateur Porno
73 Fuck Milf Porn
74 Indian Porno Tube
75 Whores Tube
76 Free Anal Movies
77 Mobile Porno Tube
78 Hidden Cams Porn
79 Popular Xxx Porn
80 Ass Moms Porn
81-120
81 Matures Free Xxx
82 Penis Sex Movies
83 Free Housewife Porn
84 Mature Free Sex
85 Sweet Milf Porn
86 Free Korean Porn
87 Mature Tube Fuck
88 Free Latina Tube
89 Older Woman Fuck
90 Free Moms Porn
91 Busty Blonde Milf
92 Mature Babe Porn
93 Dildo Sex Clips
94 Japanese Fuck Movies
95 Free Creampie Films
96 Sexy Tuber Fuck
97 Moms Sex Films
98 Tube Mayor
99 Pussy Secret Porn
100 Free Live Porn
101 Xxx Mature Videos
102 Dirty Amateur Tube
103 Free Xxx Porn
104 Free Xxx Japanese
105 Best Xxx Porn
106 Gonzo Xxx Movies
107 Free Moms Porn
108 Ebony Porn Videos
109 Stream Mature Sex
110 Asian Porn Clips
111 Free Xxx Mature
112 Free Granny Sex
113 Moms Homemade Videos
114 Perfect Mums
115 Free Mature Anal
116 Granny Porn Clips
117 Mature Wife Porn
118 Anal Tubes Films
119 Free Videos Porn
120 Fuck Porn Xxx
121-160
121 Xxx Online Porn
122 Sfico
123 Gangbang Movies Porn
124 Dildo Porn Clips
125 Maid Tube Sex
126 Indian Porn Tube
127 Oldman Porn Videos
128 Hot Lesbian Sluts
129 Hot Housewife Porn
130 Asian Mom Porn
131 Pink Dino
132 Bbw Xxx Tube
133 Mag Post
134 Mobile Tube Porn
135 Qoq Porn Tube
136 Phone Porno Videos
137 Pussy Free Porn
138 Phone Tube Sex
139 Forbidden Porno
140 Mobile Tube Xxx
141 Phone Porn Movies
142 Thai Tube Sex
143 Grow Xxx Tube
144 Lazy Porn Videos
145 Xxx Wife Cheats
146 Tube Porn Sex
147 Free Sex Movies
148 Mom Sex Tubes
149 Hot Free Xxx
150 Extra Milf Porn
151 Lesbian Porn Tube
152 Mom Sex Films
153 Full Xxx Tube
154 Indian Porn Videos
155 Free Hard Porn
156 On Movs
157 All Sex Tubes
158 Hq Porn Tube
159 Tranny Xxx Tube
160 Fuck Mom Tube
161-200
161 Free Mature Porn
162 Hairy Mobile Porno
163 Moms Xxx Movies/
164 Xxx Tube Videos
165 Dirty Mom Porn
166 Japan Xxx Movies
167 Xxx Mature Pornstar
168 Xxx Fuck Sex
169 Asian Porn Videos
170 Wow Fuck Tube
171 U Xxx Tube
172 Free Busty Porno
173 Top Fuck Tube
174 Try Free Porn
175 Free Sex Party
176 Plumper Xxx Videos
177 Suck Porn Tube
178 Matures Fuck Tube
179 Free Sex Videos
180 Xxx Tube Movies
181 Mommy Porno Videos
182 Stream Fuck
183 Free Fuck Mom
184 Fucking Movies
185 Hardsextube Porn
186 Hq Sex Tubes
187 Xvideos Porn
188 Hard Porn
189 I Free Porn
190 Grow Sex Tube
191 Brown Xxx Tube
192 Lucky Porno Tube
193 Sex Tube Life
194 Classic Fuck Tube
195 Mature Xxx Videos
196 Mom Xxx Videos
197 Matures Nude Tube
198 Wife Porno Movies
199 Hot Milf Clips
200 Pornhub
We do not own, produce or host the videos displayed on this website.
All of the videos displayed here are hosted by websites that are not under our control
Best Sex l Abuse l

Updated Time

Updating   
Friend links: ProxyFire    More...
Site Map 1 2 3 4 5 6 7 8 9 10 20 30 40 50 60 70 80 90 100 110 120 130 140 150 160 170 180 190 200 250 300 350 400 450 500 550 600 610 620 630 640 650 660 670 680 690 700 710 720 730 740 750
TOS | Contact us
© 2009 MyIP.cn Dev by MYIP Elapsed:147.846ms