INSERT INTO sites(host) VALUES('kinkygonzo.com') 1045: Access denied for user 'www-data'@'localhost' (using password: NO) kinkygonzo.com Estimated Worth $392,356 - MYIP.NET Website Information
Welcome to MyIP.net!
 Set MYIP as homepage      

  
           

Web Page Information

Title:
Meta Description:
Meta Keywords:
sponsored links:
Links:
Images:
Age:
sponsored links:

Traffic and Estimation

Traffic:
Estimation:

Website Ranks

Alexa Rank:
Google Page Rank:
Sogou Rank:
Baidu Cache:

Search Engine Indexed

Search EngineIndexedLinks
 Google:
 Bing:
 Yahoo!:
 Baidu:
 Sogou:
 Youdao:
 Soso:

Server Data

Web Server:
IP address:    
Location:

Registry information

Registrant:
Email:
ICANN Registrar:
Created:
Updated:
Expires:
Status:
Name Server:
Whois Server:

Alexa Rank and trends

Traffic: Today One Week Avg. Three Mon. Avg.
Rank:
PV:
Unique IP:

More ranks in the world

Users from these countries/regions

Where people go on this site

Alexa Charts

Alexa Reach and Rank

Whois data

Who is kinkygonzo.com at whois.evonames.com



Domain Name:
KINKYGONZO.COM

Registry Domain ID:

Registrar WHOIS Server: whois.evonames.com

Registrar URL: https://evonames.com/

Updated Date: 2016-09-14 17:36:34.576935

Creation Date: 2008-09-01

Registrar Registration Expiration Date: 2018-09-01

Registrar: EVOPLUS LTD

Registrar IANA ID: 1418

Registrar Abuse Contact Email: abuse

Registrar Abuse Contact Phone: +1.5144959001

Reseller: AHnames.com https://www.AHnames.com/

Domain Status: clientUpdateProhibited

Domain Status: clientDeleteProhibited

Domain Status: clientTransferProhibited

Registry Registrant ID: MI_6222906N

Registrant Name: Mires Titek

Registrant Organization:

Registrant Street: 4 Rue Forest apt. 27

Registrant City: Paris

Registrant State/Province:

Registrant Postal Code: 75018

Registrant Country: France

Registrant Phone: +33.970730215

Registrant Phone Ext:

Registrant Fax:

Registrant Fax Ext:

Registrant Email: info@oxotube.com

Registry Admin ID: MI_6222906N

Admin Name: Mires Titek

Admin Organization:

Admin Street: 4 Rue Forest apt. 27

Admin City: Paris

Admin State/Province:

Admin Postal Code: 75018

Admin Country: France

Admin Phone: +33.970730215

Admin Phone Ext:

Admin Fax:

Admin Fax Ext:

Admin Email: info@oxotube.com

Registry Tech ID: MI_6222906N

Tech Name: Mires Titek

Tech Organization:

Tech Street: 4 Rue Forest apt. 27

Tech City: Paris

Tech State/Province:

Tech Postal Code: 75018

Tech Country: France

Tech Phone: +33.970730215

Tech Phone Ext:

Tech Fax:

Tech Fax Ext:

Tech Email: info@oxotube.com

Registry Billing ID: MI_6222906N

Billing Name: Mires Titek

Billing Organization:

Billing Street: 4 Rue Forest apt. 27

Billing City: Paris

Billing State/Province:

Billing Postal Code: 75018

Billing Country: France

Billing Phone: +33.970730215

Billing Phone Ext:

Billing Fax:

Billing Fax Ext:

Billing Email: info@oxotube.com

Name Server: ns1.oxotube.com

Name Server: ns2.oxotube.com

DNSSEC: unsigned

URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/

>>> Last update of WHOIS database: 2017-02-02 13:25:37 <<<



Abuse email:
abuse@ahnames.com

Front Page Thumbnail

sponsored links:

Front Page Loading Time

Keyword Hits (Biger,better)

Other TLDs of kinkygonzo

TLDs Created Expires Registered
.com
.net
.org
.cn
.com.cn
.asia
.mobi

Similar Websites

More...
Alexa鏍囬

Search Engine Spider Emulation

Title:Kinky Gonzo Tube : Free Porn Videos : Private Sex Movies : XXX Anal and Big Tits Show
Description:Kinky Gonzo is the newest porn tube that is fully dedicated to high-quality free porn videos. We've done much work to gather only the most exciting exclusive sex movies and xxx videos from all over the Net to add them to our frequently updated porn archive!
Keywords:kinky gonzo, sex tube, porn tube, free porn, anal videos, amateur fuck, hardcore clips, xhamster, pornhub, asian films
Body:
Kinky Gonzo Tube : Free Porn Videos : Private Sex Movies : XXX Anal and Big Tits Show
Kinky Gonzo Tube is the newest porn tube that is fully dedicated to high-quality free porn videos. We've done much work to gather only the most exciting exclusive amateur movies and anal xvideos from all over the Net to add them to our frequently updated xxx archive! You won't find here sex movies you've already seen on dozens of other porn tubes. Only the freshest high-quality sex videos for free. You shouldn't pay for porn anymore!
Date
-any date-Yesterday2 days ago3 days ago4 days ago5 days ago6 days agoLast WeekWeek Ago
Dur
-any len-0..5 minutes5..20 minutes20..40 minutes40..60 minutes60..90 minutes gt; 90 minutes
Tube
-any tube-aShemaleTubebigXvideosDrTuberHardsextubeHDpornOverThumbsPornerBrosPornHubRedTubeSunPornoTube8VID2CXhamsterXVideosXXXKinKyYobtYouPorn
Age
-all ages-18 year old19 year olddadgrannyinnocentmaturemilfmommothernunschoolgirlsisterteenuniversityvirginyoung
Country
-all countries-africanamericanargentinianbrazilianbritishchinesecubanczechdutchegyptianfilipinafinnishfrenchgermangreekhawaiianindianindonesianitalianjapanesekoreanmexicanpakistanipolishrussianspanishswedishthaiturkish
Teen
732352 Teen Tube Videos
Forced
3996 Forced Tube Videos
Babe
483352 Babe Tube Videos
Sleeping
2434 Sleeping Tube Videos
Indian
13847 Indian Tube Videos
Milf
194081 Milf Tube Videos
Story
4415 Story Tube Videos
Monster Cock
14794 Monster Cock Tube Videos
Housewife
20442 Housewife Tube Videos
Ass
323037 Ass Tube Videos
Mature
377216 Mature Tube Videos
Vintage
35539 Vintage Tube Videos
Compilation
19243 Compilation Tube Videos
Anal
381326 Anal Tube Videos
Old Young
32495 Old Young Tube Videos
18 Year Old
27872 18 Year Old Tube Videos
Big Black Cock
47003 Big Black Cock Tube Videos
Japanese
107585 Japanese Tube Videos
Wife
60751 Wife Tube Videos
Big Natural Tits
25832 Big Natural Tits Tube Videos
Teacher
17205 Teacher Tube Videos
Office
17803 Office Tube Videos
Old Farts
2690 Old Farts Tube Videos
Shemale
107064 Shemale Tube Videos
Massage
61128 Massage Tube Videos
Bus
4500 Bus Tube Videos
Classic
10129 Classic Tube Videos
Doctor
9092 Doctor Tube Videos
Outdoor
93831 Outdoor Tube Videos
Surprise
2673 Surprise Tube Videos
Russian
68904 Russian Tube Videos
Hidden Cam
34471 Hidden Cam Tube Videos
Cheating
6055 Cheating Tube Videos
Arabian
7998 Arabian Tube Videos
Perverted
24358 Perverted Tube Videos
Lesbian
217307 Lesbian Tube Videos
Bizarre
31196 Bizarre Tube Videos
Gangbang
42966 Gangbang Tube Videos
Bbw
161053 Bbw Tube Videos
Nun
766 Nun Tube Videos
Mature Teacher
3506 Mature Teacher Tube Videos
Italian
9197 Italian Tube Videos
Public
197866 Public Tube Videos
10+ Inch Cock
3078 10+ Inch Cock Tube Videos
Swinger
11168 Swinger Tube Videos
Creampie
76412 Creampie Tube Videos
Mature Amateur
99704 Mature Amateur Tube Videos
Maid
5710 Maid Tube Videos
Cameltoe
1861 Cameltoe Tube Videos
Casting
31069 Casting Tube Videos
American
5215 American Tube Videos
Old Man
10115 Old Man Tube Videos
Game
12645 Game Tube Videos
German
26187 German Tube Videos
Pain
4250 Pain Tube Videos
Seduce
19851 Seduce Tube Videos
Orgasm
63947 Orgasm Tube Videos
Egyptian
546 Egyptian Tube Videos
Hairy
130137 Hairy Tube Videos
Squirt
21983 Squirt Tube Videos
Secretary
5768 Secretary Tube Videos
Cuckold
36580 Cuckold Tube Videos
Asian
226428 Asian Tube Videos
Student
59163 Student Tube Videos
Kinky
40299 Kinky Tube Videos
Husband
5906 Husband Tube Videos
Boss
6559 Boss Tube Videos
Jerking
53563 Jerking Tube Videos
Small Cock
25075 Small Cock Tube Videos
Tits
568388 Tits Tube Videos
Brazilian
14797 Brazilian Tube Videos
Cumshot
217604 Cumshot Tube Videos
Retro
3647 Retro Tube Videos
Group Sex
305940 Group Sex Tube Videos
Big Cock
268762 Big Cock Tube Videos
Old Young Lesbian
3873 Old Young Lesbian Tube Videos
Big Tits
442870 Big Tits Tube Videos
Monster Tits
12352 Monster Tits Tube Videos
Rocco
1795 Rocco Tube Videos
Amateur
760005 Amateur Tube Videos
Gay
268180 Gay Tube Videos
African
12527 African Tube Videos
Spy
11549 Spy Tube Videos
Upskirt
15189 Upskirt Tube Videos
3some
159768 3some Tube Videos
French
16018 French Tube Videos
Hd
85014 Hd Tube Videos
Polish
1856 Polish Tube Videos
Party
85362 Party Tube Videos
Czech
13237 Czech Tube Videos
Anime
12050 Anime Tube Videos
Cash
10053 Cash Tube Videos
Anal Creampie
26003 Anal Creampie Tube Videos
Cum Swallowing
32453 Cum Swallowing Tube Videos
Fisting
24091 Fisting Tube Videos
Cinema
429 Cinema Tube Videos
Handjob
107414 Handjob Tube Videos
Bdsm
167940 Bdsm Tube Videos
Home Made
99900 Home Made Tube Videos
Nurse
10694 Nurse Tube Videos
Mexican
3390 Mexican Tube Videos
Pakistani
670 Pakistani Tube Videos
Masturbating
378965 Masturbating Tube Videos
Strap On
78354 Strap On Tube Videos
Gym
12386 Gym Tube Videos
Deepthroat
46565 Deepthroat Tube Videos
Interracial
165898 Interracial Tube Videos
Couple
223700 Couple Tube Videos
Ebony
213232 Ebony Tube Videos
Bisexual
44762 Bisexual Tube Videos
Panties
37253 Panties Tube Videos
Chubby
25872 Chubby Tube Videos
Cum In Mouth
33509 Cum In Mouth Tube Videos
19 Year Old
15521 19 Year Old Tube Videos
Beach
11572 Beach Tube Videos
Kitchen
10490 Kitchen Tube Videos
Black
181629 Black Tube Videos
Pornstar
144969 Pornstar Tube Videos
Fat Mature
8758 Fat Mature Tube Videos
Mistress
29297 Mistress Tube Videos
Lesbian Teen
56562 Lesbian Teen Tube Videos
Mature Lesbian
43726 Mature Lesbian Tube Videos
Milk
6384 Milk Tube Videos
Midget
1154 Midget Tube Videos
Beauty
125436 Beauty Tube Videos
Big Ass
125272 Big Ass Tube Videos
Ugly
1312 Ugly Tube Videos
Car
15836 Car Tube Videos
Army
941 Army Tube Videos
Cum
242970 Cum Tube Videos
Tranny
128789 Tranny Tube Videos
Slave
25275 Slave Tube Videos
Korean
7225 Korean Tube Videos
Webcam
117516 Webcam Tube Videos
Latina
108354 Latina Tube Videos
Fat Teen
16598 Fat Teen Tube Videos
Hermaphrodite
171 Hermaphrodite Tube Videos
Busty
143395 Busty Tube Videos
Rimjob
12549 Rimjob Tube Videos
Prostate
1234 Prostate Tube Videos
Voyeur
113533 Voyeur Tube Videos
Femdom
42477 Femdom Tube Videos
Nipples
19848 Nipples Tube Videos
Thai
7093 Thai Tube Videos
Hardcore
833716 Hardcore Tube Videos
Flasher
33284 Flasher Tube Videos
Barely Legal
22330 Barely Legal Tube Videos
Filipina
2090 Filipina Tube Videos
Fat
46073 Fat Tube Videos
Prostitute
25178 Prostitute Tube Videos
Mmf
6476 Mmf Tube Videos
Girl
482672 Girl Tube Videos
Stockings
82029 Stockings Tube Videos
Crazy
22713 Crazy Tube Videos
Turkish
3471 Turkish Tube Videos
Farm
763 Farm Tube Videos
Sex
655453 Sex Tube Videos
Reality
100173 Reality Tube Videos
Chinese
10617 Chinese Tube Videos
Greek
547 Greek Tube Videos
Nudist
18926 Nudist Tube Videos
Orgy
62484 Orgy Tube Videos
Perky
38818 Perky Tube Videos
British
21245 British Tube Videos
Natural Boobs
21187 Natural Boobs Tube Videos
Melons
15391 Melons Tube Videos
Feminization
2058 Feminization Tube Videos
Blowjob
1165603 Blowjob Tube Videos
Fucking
823112 Fucking Tube Videos
Solo
143728 Solo Tube Videos
Crossdressing
13394 Crossdressing Tube Videos
Indonesian
438 Indonesian Tube Videos
Saggy Tits
1020 Saggy Tits Tube Videos
Enema
716 Enema Tube Videos
Pussy
424306 Pussy Tube Videos
Blonde
373062 Blonde Tube Videos
Mardi Gras
116 Mardi Gras Tube Videos
Oldy
6642 Oldy Tube Videos
Swedish
2882 Swedish Tube Videos
Pantyhose
20131 Pantyhose Tube Videos
Date
-any date-Yesterday2 days ago3 days ago4 days ago5 days ago6 days agoLast WeekWeek Ago
Dur
-any len-0..5 minutes5..20 minutes20..40 minutes40..60 minutes60..90 minutes gt; 90 minutes
Tube
-any tube-aShemaleTubebigXvideosDrTuberHardsextubeHDpornOverThumbsPornerBrosPornHubRedTubeSunPornoTube8VID2CXhamsterXVideosXXXKinKyYobtYouPorn
Age
-all ages-18 year old19 year olddadgrannyinnocentmaturemilfmommothernunschoolgirlsisterteenuniversityvirginyoung
Country
-all countries-africanamericanargentinianbrazilianbritishchinesecubanczechdutchegyptianfilipinafinnishfrenchgermangreekhawaiianindianindonesianitalianjapanesekoreanmexicanpakistanipolishrussianspanishswedishthaiturkish
Today top searches
Search
. 18 year old orgasm
. Abused anal raped
. Anal pawg
. Babe inocent
. Bar strip
. Bella bellz
. Big black cock teen
. Black pussy
. Bra
. Brazilian mature
. Chubby anal
. Cum his mouth
. Dad spanking daughter
. Dadd fucked
. Ffm anal
. Gangbang cum swallow
. Gangbang slaves
. Hot india
. Jap granny
. Japanese cam
. Japanese milf bondage
. Keisha
. Lesbian mom an
. Mama russian
. Mature big natural tits
. Mature first big cock
. Mom daughter son dad
. Mom son story
. Myanmar
. Orgy weird
. Petite creampie
. Pool cabin
. Pov rape
. Public disgrace
. Pussy lips
. Samoa
. Scat girl
. Toilet head
. Voyer
. Watching hubby husband

Free Porn Videos
Today top tube Pornstars listing
Search
A
B
C
D
E
F
G
H
I
J
K
L
M
N
O
P
Q
R
S
T
U
V
W
X
Y
Z
. Adam
. Aiden Starr
. Andrea Acosta
. Anita Berlusconi
. Anita Black
. Barbara Ross
. Bree
. Camila Bella
. Charlie Lane
. Cole Conner
. Day
. Duval
. Ezra
. Gia Regency
. Ginger Blaze
. Jennifer Jason Leigh
. Jeyne Riley
. Kana Kawai
. Karen Kam
. Kimber Kay
. Laura Singer
. Lee Lexxus
. Marcella
. Milla Yul
. Misha Cross
. Nano
. Penelope Cruz
. Scarlett Fay
. Shae Parker
. Shauna Grant
. Sofia Cortez
. Susi Gala
. Victoria Lawson
. Whitney Fears

A
B
C
D
E
F
G
H
I
J
K
L
M
N
O
P
Q
R
S
T
U
V
W
X
Y
Z
Free Pornstar Videos
Top List of Porn Tube Sites
1-40
01 Latin Tube Porn
02 Xxx Sex Anal
03 24x7 Porn Tube
04 Video One
05 Porn Tube Movies
06 Free Classic Porn
07 Sexy Xxx Babes
08 Hot Milf Clips
09 Arion Porn Movies
10 Free Sex Party
11 X Hamster Hq
12 Dino Tube
13 Xxx Videos
14 My Xxx Movies
15 Gonzo Xxx Movies
16 Mom Tube Sex
17 Hq Porn Tube
18 World Porn Movies
19 Classic Fuck Tube
20 Beeg Porn Tube
21 Sex Tube Videos
22 Stream Fuck
23 Mature Videos Porn
24 Fat Fuck Xxx
25 Chubby Porn Xxx
26 Anal Sex Tube
27 Mrs Sex Tube
28 Stream Sex Videos
29 White Porn Tube
30 Wife Porno Movies
31 Pornhub
32 Free Naked Mature
33 Free Hairy Porno
34 Beez Tube
35 Extreme Fetish Videos
36 Sexy Asian Movies
37 Mobile Tube Porn
38 Best Sex Tube
39 Phone Porno Videos
40 All Sex Tubes
41-80
41 Phone Tube Sex
42 Matures Free Xxx
43 Xhamster Porn
44 Mobile Tube Xxx
45 Big Sex Videos
46 Ass Moms Porn
47 Free Porn Tubes
48 Boobs Sex Videos
49 Paris Tube Porn
50 Group Fuck Movies
51 Indian Porno Tube
52 Redtube Porn
53 Stream Mature Sex
54 Free Creampie Films
55 Free Xxx Movies
56 Boobs Xxx Videos
57 Free Fuck Tube
58 Hardsextube Porn
59 Beeg Tube
60 Unshaven Armpit Porn
61 Xvideos Porn
62 Sexy Hairy Women
63 I Free Porn
64 Free Boobs Porn
65 Hardsextube
66 Granny Porn Videos
67 African Xxx Movies
68 Free Amateur Porn
69 Granny Xxx Films
70 Sex Tube Club
71 Xxx Tube Movies
72 Whores Tube
73 Hq Sex Tubes
74 Hard Porn
75 Brown Xxx Tube
76 Sex Tube Sun
77 Mag Post
78 DT Video
79 Joker Sex Tube
80 Jizz Tube Porn
81-120
81 Anal Xxx Tube
82 Fuck Anal Tube
83 Xhamster
84 Hidden Cams Porn
85 Free Sex Movies
86 Tube Porn Sex
87 Popular Xxx Porn
88 Free Fuck Cams
89 41 XXX Tube
90 Xxx Wife Cheats
91 Sfico
92 Penis Sex Movies
93 Free Housewife Porn
94 Mature Free Sex
95 Sweet Milf Porn
96 Free Sex Porn
97 Mature Babe Porn
98 Free Korean Porn
99 Mature Tube Fuck
100 Free Latina Tube
101 Free Moms Porn
102 Busty Blonde Milf
103 Mobile Porno Tube
104 Free Anal Movies
105 Moms Homemade Videos
106 Wife Porn Movies
107 Mobile Xxx Porn
108 Amateur Tube Porn
109 Sexy Tuber Fuck
110 Moms Sex Films
111 Pussy Secret Porn
112 Free Live Porn
113 Xxx Mature Videos
114 Mature Sex Clips
115 Free Xxx Porn
116 Free Xxx Japanese
117 Best Xxx Porn
118 Free Moms Porn
119 Ebony Porn Videos
120 Full Xxx Tube
121-160
121 Asian Porn Clips
122 Free Xxx Mature
123 Free Granny Sex
124 Free Xxx Clips
125 Free Mature Anal
126 Granny Porn Clips
127 Mature Wife Porn
128 Anal Tubes Films
129 Free Videos Porn
130 On Movs
131 Fuck Porn Xxx
132 Xxx Online Porn
133 Tube Porno Videos
134 Gangbang Movies Porn
135 Dildo Porn Clips
136 Maid Tube Sex
137 Indian Porn Tube
138 Oldman Porn Videos
139 Hot Lesbian Sluts
140 Hot Housewife Porn
141 Asian Mom Porn
142 Mommy Porn Videos
143 Bbw Xxx Tube
144 69 Tube Porn
145 Gangbang Sex Tube
146 Massage Xxx Movies
147 XaX Tube
148 Pussy Free Porn
149 Hot Tube
150 Forbidden Porno
151 Qoq Porn Tube
152 Phone Porn Movies
153 Thai Tube Sex
154 Grow Xxx Tube
155 Lazy Porn Videos
156 Grow Porn Videos
157 Mom Sex Tubes
158 Hot Free Xxx
159 Extra Milf Porn
160 Lesbian Porn Tube
161-200
161 Hot Fuck Webcam
162 Mom Sex Films
163 Free Xxx Cam
164 Porn Chats Online
165 Indian Porn Videos
166 Vip Porn Cams
167 Free Hard Porn
168 Hd Sex Tubes
169 Pink Dino
170 Tranny Xxx Tube
171 Fuck Mom Tube
172 Free Mature Porn
173 Fresh Asian Porn
174 Hairy Mobile Porno
175 Moms Xxx Movies/
176 Xxx Tube Videos
177 Dirty Mom Porn
178 Forbidden Moms Porn
179 Japan Xxx Movies
180 Xxx Mature Pornstar
181 Xxx Fuck Sex
182 Asian Porn Videos
183 Bbw Fuck Videos
184 Free Moms Sex
185 Free Sex Videos
186 Mommy Porno Videos
187 Moms Fuck
188 Free Fuck Mom
189 Fucking Movies
190 All Fuck Tube
191 Fuck Tube Movies
192 Grow Sex Tube
193 Movs Porn Tube
194 Lucky Porno Tube
195 Free Sex Tube
196 Sex Tube Life
197 Latina Fuck Tube
198 Ass Porno Tube
199 Pornhub Videos
200 Free Anal Tube
We do not own, produce or host the videos displayed on this website.
All of the videos displayed here are hosted by websites that are not under our control
Best Sex l Abuse l

Updated Time

Updating   
Friend links: ProxyFire    More...
Site Map 1 2 3 4 5 6 7 8 9 10 20 30 40 50 60 70 80 90 100 110 120 130 140 150 160 170 180 190 200 250 300 350 400 450 500 550 600 610 620 630 640 650 660 670 680 690 700 710 720 730 740 750
TOS | Contact us
© 2009 MyIP.cn Dev by MYIP Elapsed:1.589ms