INSERT INTO sites(host) VALUES('kinkygonzo.com') 1045: Access denied for user 'www-data'@'localhost' (using password: NO) kinkygonzo.com Estimated Worth $265,956 - MYIP.NET Website Information
Welcome to MyIP.net!
 Set MYIP as homepage      

  
           

Web Page Information

Title:
Meta Description:
Meta Keywords:
sponsored links:
Links:
Images:
Age:
sponsored links:

Traffic and Estimation

Traffic:
Estimation:

Website Ranks

Alexa Rank:
Google Page Rank:
Sogou Rank:
Baidu Cache:

Search Engine Indexed

Search EngineIndexedLinks
 Google:
 Bing:
 Yahoo!:
 Baidu:
 Sogou:
 Youdao:
 Soso:

Server Data

Web Server:
IP address:    
Location:

Registry information

Registrant:
Email:
ICANN Registrar:
Created:
Updated:
Expires:
Status:
Name Server:
Whois Server:

Alexa Rank and trends

Traffic: Today One Week Avg. Three Mon. Avg.
Rank:
PV:
Unique IP:

More ranks in the world

Users from these countries/regions

Where people go on this site

Alexa Charts

Alexa Reach and Rank

Whois data

Who is kinkygonzo.com at whois.evonames.com



Domain Name:
KINKYGONZO.COM

Registry Domain ID:

Registrar WHOIS Server: whois.evonames.com

Registrar URL: https://evonames.com/

Updated Date: 2017-03-13 07:40:00.985097

Creation Date: 2008-09-01

Registrar Registration Expiration Date: 2018-09-01

Registrar: EVOPLUS LTD

Registrar IANA ID: 1418

Registrar Abuse Contact Email: abuse

Registrar Abuse Contact Phone: +357.95713635

Reseller: AHnames.com https://www.AHnames.com/

Domain Status: clientUpdateProhibited

Domain Status: clientDeleteProhibited

Domain Status: clientTransferProhibited

Registry Registrant ID: MI_6222906N

Registrant Name: Mires Titek

Registrant Organization:

Registrant Street: 4 Rue Forest apt. 27

Registrant City: Paris

Registrant State/Province:

Registrant Postal Code: 75018

Registrant Country: France

Registrant Phone: +33.970730215

Registrant Phone Ext:

Registrant Fax:

Registrant Fax Ext:

Registrant Email: info@oxotube.com

Registry Admin ID: MI_6222906N

Admin Name: Mires Titek

Admin Organization:

Admin Street: 4 Rue Forest apt. 27

Admin City: Paris

Admin State/Province:

Admin Postal Code: 75018

Admin Country: France

Admin Phone: +33.970730215

Admin Phone Ext:

Admin Fax:

Admin Fax Ext:

Admin Email: info@oxotube.com

Registry Tech ID: MI_6222906N

Tech Name: Mires Titek

Tech Organization:

Tech Street: 4 Rue Forest apt. 27

Tech City: Paris

Tech State/Province:

Tech Postal Code: 75018

Tech Country: France

Tech Phone: +33.970730215

Tech Phone Ext:

Tech Fax:

Tech Fax Ext:

Tech Email: info@oxotube.com

Registry Billing ID: MI_6222906N

Billing Name: Mires Titek

Billing Organization:

Billing Street: 4 Rue Forest apt. 27

Billing City: Paris

Billing State/Province:

Billing Postal Code: 75018

Billing Country: France

Billing Phone: +33.970730215

Billing Phone Ext:

Billing Fax:

Billing Fax Ext:

Billing Email: info@oxotube.com

Name Server: ns1.oxotube.com

Name Server: ns2.oxotube.com

DNSSEC: unsigned

URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/

>>> Last update of WHOIS database: 2017-05-28 22:25:34 <<<



Abuse email:
abuse@ahnames.com

Front Page Thumbnail

sponsored links:

Front Page Loading Time

Keyword Hits (Biger,better)

Other TLDs of kinkygonzo

TLDs Created Expires Registered
.com
.net
.org
.cn
.com.cn
.asia
.mobi

Similar Websites

More...
Alexa鏍囬

Search Engine Spider Emulation

Title:Kinky Gonzo Tube : Free Porn Videos : Private Sex Movies : XXX Anal and Big Tits Show
Description:Kinky Gonzo is the newest porn tube that is fully dedicated to high-quality free porn videos. We've done much work to gather only the most exciting exclusive sex movies and xxx videos from all over the Net to add them to our frequently updated porn archive!
Keywords:kinky gonzo, sex tube, porn tube, free porn, anal videos, amateur fuck, hardcore clips, xhamster, pornhub, asian films
Body:
Kinky Gonzo Tube : Free Porn Videos : Private Sex Movies : XXX Anal and Big Tits Show
Kinky Gonzo Tube is the newest porn tube that is fully dedicated to high-quality free porn videos. We've done much work to gather only the most exciting exclusive amateur movies and anal xvideos from all over the Net to add them to our frequently updated xxx archive! You won't find here sex movies you've already seen on dozens of other porn tubes. Only the freshest high-quality sex videos for free. You shouldn't pay for porn anymore!
Date
-any date-Yesterday2 days ago3 days agoLast WeekWeek Ago
Dur
-any len-0..5 minutes5..20 minutes20..40 minutes40..60 minutes60..90 minutes gt; 90 minutes
Tube
-any tube-aShemaleTubebigXvideosDrTuberHardsextubeHDpornOverThumbsPornerBrosPornHubRedTubeSunPornoTube8VID2CXhamsterXVideosXXXKinKyYobtYouPorn
Age
-all ages-18 year old19 year olddadgrannyinnocentmaturemilfmommothernunschoolgirlsisterteenuniversityvirginyoung
Country
-all countries-africanamericanargentinianbrazilianbritishchinesecubanczechdutchegyptianfilipinafinnishfrenchgermangreekhawaiianindianindonesianitalianjapanesekoreanmexicanpakistanipolishrussianspanishswedishthaiturkish
Old Young
28466 Old Young Tube Videos
Teen
688786 Teen Tube Videos
Housewife
17593 Housewife Tube Videos
Indian
13622 Indian Tube Videos
Monster Cock
10601 Monster Cock Tube Videos
Forced
2833 Forced Tube Videos
Sleeping
1983 Sleeping Tube Videos
Mature
355329 Mature Tube Videos
Babe
445593 Babe Tube Videos
Milf
181674 Milf Tube Videos
Cheating
5781 Cheating Tube Videos
Story
3522 Story Tube Videos
Japanese
102013 Japanese Tube Videos
Office
15972 Office Tube Videos
Big Natural Tits
18448 Big Natural Tits Tube Videos
Old Man
8352 Old Man Tube Videos
Anal
349146 Anal Tube Videos
Classic
9696 Classic Tube Videos
Big Black Cock
42837 Big Black Cock Tube Videos
Massage
55544 Massage Tube Videos
Bus
4078 Bus Tube Videos
Wife
56487 Wife Tube Videos
Teacher
15558 Teacher Tube Videos
Home Made
81141 Home Made Tube Videos
Chubby
24269 Chubby Tube Videos
Shemale
105178 Shemale Tube Videos
Doctor
8643 Doctor Tube Videos
Orgasm
54469 Orgasm Tube Videos
Ass
291161 Ass Tube Videos
Gangbang
37776 Gangbang Tube Videos
Vintage
34617 Vintage Tube Videos
Old Farts
1925 Old Farts Tube Videos
Italian
9217 Italian Tube Videos
Public
180221 Public Tube Videos
Lesbian
200014 Lesbian Tube Videos
Compilation
18879 Compilation Tube Videos
Creampie
68548 Creampie Tube Videos
Nurse
9914 Nurse Tube Videos
3some
144708 3some Tube Videos
Bizarre
25071 Bizarre Tube Videos
Casting
21858 Casting Tube Videos
Mature Teacher
3053 Mature Teacher Tube Videos
Big Cock
253789 Big Cock Tube Videos
German
25902 German Tube Videos
18 Year Old
22922 18 Year Old Tube Videos
Party
71510 Party Tube Videos
Cumshot
196057 Cumshot Tube Videos
Swinger
10819 Swinger Tube Videos
Maid
5371 Maid Tube Videos
Feminization
1929 Feminization Tube Videos
Russian
66121 Russian Tube Videos
Nun
705 Nun Tube Videos
Seduce
17231 Seduce Tube Videos
Ebony
195083 Ebony Tube Videos
Hd
87368 Hd Tube Videos
Surprise
2414 Surprise Tube Videos
Gym
9371 Gym Tube Videos
Pain
3342 Pain Tube Videos
Hidden Cam
34444 Hidden Cam Tube Videos
Husband
5542 Husband Tube Videos
Tranny
126639 Tranny Tube Videos
Cash
8126 Cash Tube Videos
Arabian
7961 Arabian Tube Videos
American
4810 American Tube Videos
Animation
11106 Animation Tube Videos
Perverted
19945 Perverted Tube Videos
Brazilian
14454 Brazilian Tube Videos
Latina
102951 Latina Tube Videos
Boss
5982 Boss Tube Videos
Bdsm
149416 Bdsm Tube Videos
Barely Legal
19011 Barely Legal Tube Videos
Bbw
144660 Bbw Tube Videos
Game
10750 Game Tube Videos
Asian
217619 Asian Tube Videos
French
15691 French Tube Videos
Interracial
147835 Interracial Tube Videos
Hairy
110239 Hairy Tube Videos
Monster Tits
7469 Monster Tits Tube Videos
Pakistani
540 Pakistani Tube Videos
Cinema
386 Cinema Tube Videos
Cuckold
27561 Cuckold Tube Videos
Squirt
20970 Squirt Tube Videos
Anime
11864 Anime Tube Videos
Big Ass
116488 Big Ass Tube Videos
Midget
1068 Midget Tube Videos
Army
816 Army Tube Videos
Gay
255167 Gay Tube Videos
Beach
11059 Beach Tube Videos
Hardcore
744172 Hardcore Tube Videos
Couple
205063 Couple Tube Videos
Cum In Mouth
20561 Cum In Mouth Tube Videos
Secretary
5256 Secretary Tube Videos
Retro
3360 Retro Tube Videos
Cameltoe
1687 Cameltoe Tube Videos
Amateur
714722 Amateur Tube Videos
Voyeur
108710 Voyeur Tube Videos
Cum Swallowing
20373 Cum Swallowing Tube Videos
Czech
12205 Czech Tube Videos
Busty
127131 Busty Tube Videos
Mature Amateur
94097 Mature Amateur Tube Videos
Handjob
93075 Handjob Tube Videos
Orgy
47421 Orgy Tube Videos
Anal Creampie
20445 Anal Creampie Tube Videos
10+ Inch Cock
1788 10+ Inch Cock Tube Videos
Sex
561575 Sex Tube Videos
Group Sex
269554 Group Sex Tube Videos
Black
165962 Black Tube Videos
Pussy
362268 Pussy Tube Videos
Kinky
34126 Kinky Tube Videos
Fisting
22376 Fisting Tube Videos
Oldy
5215 Oldy Tube Videos
Bisexual
27427 Bisexual Tube Videos
Natural Boobs
13320 Natural Boobs Tube Videos
Mexican
3440 Mexican Tube Videos
Old Young Lesbian
2553 Old Young Lesbian Tube Videos
British
18770 British Tube Videos
19 Year Old
11506 19 Year Old Tube Videos
Chinese
9009 Chinese Tube Videos
Hospital
2552 Hospital Tube Videos
Polish
1762 Polish Tube Videos
Masturbating
362179 Masturbating Tube Videos
Deepthroat
40835 Deepthroat Tube Videos
Mature Lesbian
38501 Mature Lesbian Tube Videos
African
11809 African Tube Videos
Spy
10726 Spy Tube Videos
Filipina
2019 Filipina Tube Videos
Beauty
108488 Beauty Tube Videos
Strap On
58850 Strap On Tube Videos
Fat
41796 Fat Tube Videos
Nudist
18306 Nudist Tube Videos
Rocco
1598 Rocco Tube Videos
Slave
21535 Slave Tube Videos
Fat Mature
7889 Fat Mature Tube Videos
Turkish
3596 Turkish Tube Videos
Fucking
720001 Fucking Tube Videos
Girl
415629 Girl Tube Videos
Solo
133896 Solo Tube Videos
Kitchen
9228 Kitchen Tube Videos
Outdoor
85928 Outdoor Tube Videos
Reality
76094 Reality Tube Videos
Lesbian Teen
51281 Lesbian Teen Tube Videos
Car
14511 Car Tube Videos
Rimjob
11344 Rimjob Tube Videos
Prostate
1113 Prostate Tube Videos
Blowjob
1060843 Blowjob Tube Videos
Big Tits
406270 Big Tits Tube Videos
Cum
211376 Cum Tube Videos
Perky
32596 Perky Tube Videos
Panties
30624 Panties Tube Videos
Thai
6746 Thai Tube Videos
Milk
5996 Milk Tube Videos
Tits
518022 Tits Tube Videos
Pornstar
128188 Pornstar Tube Videos
Jerking
44926 Jerking Tube Videos
Flasher
28468 Flasher Tube Videos
Mistress
24360 Mistress Tube Videos
Upskirt
14843 Upskirt Tube Videos
Crossdressing
11779 Crossdressing Tube Videos
Korean
5682 Korean Tube Videos
Ugly
1192 Ugly Tube Videos
Indonesian
450 Indonesian Tube Videos
Stockings
74905 Stockings Tube Videos
Student
49364 Student Tube Videos
Melons
10493 Melons Tube Videos
Big Nipples
7300 Big Nipples Tube Videos
Egyptian
549 Egyptian Tube Videos
Hermaphrodite
150 Hermaphrodite Tube Videos
Femdom
37458 Femdom Tube Videos
Crazy
21525 Crazy Tube Videos
Tgirl
16988 Tgirl Tube Videos
Fat Teen
14901 Fat Teen Tube Videos
Prostitute
14360 Prostitute Tube Videos
Mmf
5032 Mmf Tube Videos
Swedish
2807 Swedish Tube Videos
Enema
689 Enema Tube Videos
Blonde
345485 Blonde Tube Videos
Webcam
117907 Webcam Tube Videos
Small Cock
21349 Small Cock Tube Videos
Nipples
17047 Nipples Tube Videos
Farm
660 Farm Tube Videos
Date
-any date-Yesterday2 days ago3 days agoLast WeekWeek Ago
Dur
-any len-0..5 minutes5..20 minutes20..40 minutes40..60 minutes60..90 minutes gt; 90 minutes
Tube
-any tube-aShemaleTubebigXvideosDrTuberHardsextubeHDpornOverThumbsPornerBrosPornHubRedTubeSunPornoTube8VID2CXhamsterXVideosXXXKinKyYobtYouPorn
Age
-all ages-18 year old19 year olddadgrannyinnocentmaturemilfmommothernunschoolgirlsisterteenuniversityvirginyoung
Country
-all countries-africanamericanargentinianbrazilianbritishchinesecubanczechdutchegyptianfilipinafinnishfrenchgermangreekhawaiianindianindonesianitalianjapanesekoreanmexicanpakistanipolishrussianspanishswedishthaiturkish
Today top searches
Search
. 1950
. 3d
. 3d monster
. Alcohol
. Alexandra paul
. Amateur wife interracial
. Anal videos
. Brother fuck sister
. Brutal teen abuse
. Cosplay
. Dad seduce
. Dicks
. Family father mother son daughter
. Famous toon
. Forced father
. German homemade
. Handjob slow
. Homemade
. Horse fucking girls
. Hot mom russian
. Housewife cheating
. Indian aunty porn
. Indian force sex
. Indian teacher
. Interracial wife
. Invisible
. Kiddy
. Mallu lesbian
. Milk pregnant
. Mom daughter
. Nipple bite
. Petite high heels
. Schoolgirls time stop
. Second thoughts
. Sexe mom
. She guy
. Skinny asian
. Story mom
. Webcam family
. Wife swap

Free Porn Videos
Today top tube Pornstars listing
Search
A
B
C
D
E
F
G
H
I
J
K
L
M
N
O
P
Q
R
S
T
U
V
W
X
Y
Z
. Addison
. Aiden Summers
. Alexia Sky
. Amelie
. Amile Waters
. Angelina Wild
. Ani
. Aries Stone
. Arisa Himeno
. Bb Gunn
. Daisy Woods
. Daphnee
. Dunja
. Ed
. Gia Serena
. Gigi
. Hillary Hooterz
. Jamie Markham
. Jan
. Jane Marie
. Jennyfer
. Jessi Foster
. Jessica Ryan
. Joachim Kessef
. Kiesha Kane
. Lo
. Marcellinha Moraes
. Maya Hill
. Nadia Fernandez
. Nicole Taylor
. Sable Simms
. Sai
. Vanessa Lynn

A
B
C
D
E
F
G
H
I
J
K
L
M
N
O
P
Q
R
S
T
U
V
W
X
Y
Z
Free Pornstar Videos
Top List of Porn Tube Sites
1-40
01 Latin Tube Porn
02 Sex Tube Club
03 Xxx Sex Anal
04 Xxx Fuck Porn
05 Free Fuck Tube
06 41 XXX Tube
07 Japanese Fuck Movies
08 Free Classic Porn
09 Latina Fuck Tube
10 Granny Porn Videos
11 Bbw Fuck Videos
12 Hot Milf Clips
13 Hot Free Xxx
14 Arion Porn Movies
15 Video One
16 Free Porn Tubes
17 Fuck Porn Xxx
18 Try Free Porn
19 Matures Fuck Tube
20 Sex Tube Sun
21 Sfico
22 Wow Fuck Tube
23 Beeg Porn Tube
24 Paris Tube Porn
25 All Sex Tubes
26 Anal Sex Tube
27 Mom Tube Sex
28 DT Video
29 Full Xxx Tube
30 Dino Tube
31 Free Sex Tube
32 Mature Tube Fuck
33 X Hamster Hq
34 Free Naked Mature
35 Matures Nude Tube
36 Xhamster Porn
37 Mom Fuck Video
38 Mom Xxx Videos
39 Group Fuck Movies
40 Free Xxx Cam
41-80
41 Indian Porno Tube
42 Sexy Xxx Babes
43 Adult Movies
44 Sexy Asian Movies
45 Qoq Porn Tube
46 Free Anal Tube
47 Xxx Hd Videos
48 Free Sex Videos
49 Mag Post
50 Hardsextube
51 Free Milf Ass
52 Fucking Movies
53 Suck Porn Tube
54 Mobile Xxx Porn
55 Xxx Mature Videos
56 Free Xxx Movies
57 Fat Fuck Tube
58 Hot Fuck Films
59 Fuck Tube Movies
60 Fuck Anal Tube
61 Porn Tube Movies
62 Hard Porn
63 Brown Xxx Tube
64 Hq Sex Tubes
65 Movs Porn Tube
66 All Fuck Tube
67 Gangbang Sex Tube
68 Dirty Mom Porn
69 69 Tube Porn
70 U Xxx Tube
71 Moms Xxx Movies/
72 Free Xxx Tube
73 Best Sex Tube
74 My Xxx Movies
75 Fresh Asian Porn
76 Hard Porn
77 Mobile Tube Xxx
78 Hard Amateur Porno
79 Anal Sex Tube
80 Amateur Fuck Tubes
81-120
81 Best Hardcore Sex
82 Tube Porno Sex
83 Free Squirt Porno
84 Mommy Porn Videos
85 Hq Porn Tubes
86 Mobile Tube Porn
87 Massage Xxx Movies
88 Phone Porno Videos
89 Hidden Cam Porn
90 Naked Boobs Porn
91 Massive Melons Porn
92 Free Sex Videos
93 Pussy Free Porn
94 Free Hairy Porno
95 Extreme Fetish Videos
96 Sexy Hairy Women
97 Phone Tube Sex
98 Xxx Tube Clips
99 Forbidden Porno
100 Phone Porn Movies
101 Hd Sex Tubes
102 Free Mature Porn
103 Thai Tube Sex
104 Mom Sex Tubes
105 Free Sex Porn
106 Free Korean Porn
107 Mature Free Sex
108 Penis Sex Movies
109 Ass Moms Porn
110 Japan Xxx Movies
111 Xxx Mature Pornstar
112 Mature Wife Porn
113 Granny Porn Clips
114 Xxx Fuck Sex
115 Free Mature Anal
116 Best Xxx Porn
117 Free Xxx Japanese
118 Free Xxx Porn
119 Mature Sex Clips
120 Mobile Porno Tube
121-160
121 Xxx Online Porn
122 Indian Porn Tube
123 Asian Mom Porn
124 Older Woman Fuck
125 Grow Porn Videos
126 Hd Porn Series
127 Outdoors Sex Videos
128 Stream Fuck
129 Xxx Tube Movies
130 Free Sex Videos
131 Brown Porn Tube
132 Milf Fuck
133 Mrs Sex Tube
134 Fuck Milf Porn
135 Mature Xxx Videos
136 Xhamster
137 Wife Porno Movies
138 Pornhub
139 Jizz Tube Porn
140 Wife Porn Tube
141 White Porn Tube
142 Xvideos Sex
143 Big Sex Videos
144 Stream Sex Videos
145 Pink Dino
146 On Movs
147 Xxx Videos
148 Whores Tube
149 Perfect Mums
150 Dirty Amateur Tube
151 Beez Tube
152 Tube Mayor
153 Gonzo Xxx Movies
154 GrannySex TubeZ
155 Joker Sex Tube
156 Xxx Tube List
157 Fuck Tube Club
158 Anal Xxx Tube
159 Free Sex Tube
160 Lucky Porno Tube
161-200
161 24x7 Porn Tube
162 Sex Tube Videos
163 Xvideos Porn
164 Grow Sex Tube
165 Free Boobs Porn
166 African Xxx Movies
167 Classic Fuck Tube
168 Ass Porno Tube
169 Free Ebony Clips
170 Spy Videos Tubes
171 Stream ViD
172 Granny Xxx Films
173 Busty Lesbian Porn
174 Mixed Race Porn
175 Hard Spy Porn
176 Free Amateur Porn
177 Xxx Tube Movies
178 Homemade Sex
179 World Porn Movies
180 Honey Porn Tube
181 Youporn.com
182 Boobs Sex Videos
183 Mature Nude Porn
184 Redtube Porn
185 Oral Sex Movies
186 Fat Fuck Xxx
187 World Xxx Tube
188 Mature Videos Porn
189 Free Busty Porno
190 Top Fuck Tube
191 Free Sex Party
192 Plumper Xxx Videos
193 Free Moms Sex
194 Mommy Porno Videos
195 Moms Fuck
196 Free Fuck Mom
197 Hardsextube Porn
198 Beeg Tube
199
200
We do not own, produce or host the videos displayed on this website.
All of the videos displayed here are hosted by websites that are not under our control
Best Sex l Abuse l

Updated Time

Updating   
Friend links: ProxyFire    More...
Site Map 1 2 3 4 5 6 7 8 9 10 20 30 40 50 60 70 80 90 100 110 120 130 140 150 160 170 180 190 200 250 300 350 400 450 500 550 600 610 620 630 640 650 660 670 680 690 700 710 720 730 740 750
TOS | Contact us
© 2009 MyIP.cn Dev by MYIP Elapsed:36.643ms