INSERT INTO sites(host) VALUES('kinkygonzo.com') 1045: Access denied for user 'www-data'@'localhost' (using password: NO) kinkygonzo.com Estimated Worth $92,824 - MYIP.NET Website Information
Welcome to MyIP.net!
 Set MYIP as homepage      

  
           

Web Page Information

Title:
Meta Description:
Meta Keywords:
sponsored links:
Links:
Images:
Age:
sponsored links:

Traffic and Estimation

Traffic:
Estimation:

Website Ranks

Alexa Rank:
Google Page Rank:
Sogou Rank:
Baidu Cache:

Search Engine Indexed

Search EngineIndexedLinks
 Google:
 Bing:
 Yahoo!:
 Baidu:
 Sogou:
 Youdao:
 Soso:

Server Data

Web Server:
IP address:    
Location:

Registry information

Registrant:
Email:
ICANN Registrar:
Created:
Updated:
Expires:
Status:
Name Server:
Whois Server:

Alexa Rank and trends

Traffic: Today One Week Avg. Three Mon. Avg.
Rank:
PV:
Unique IP:

More ranks in the world

Users from these countries/regions

Where people go on this site

Alexa Charts

Alexa Reach and Rank

Whois data

Who is kinkygonzo.com at com.whois-servers.net

Domain Name: KINKYGONZO.COM

Registry Domain ID: 1517363132_DOMAIN_COM-VRSN

Registrar WHOIS Server: whois.evonames.com

Registrar URL:
http://www.danesconames.com

Updated Date: 2016-04-05T08:24:45Z

Creation Date: 2008-09-01T19:36:16Z

Registry Expiry Date: 2018-09-01T19:36:16Z

Registrar: Danesco Trading Ltd.

Registrar IANA ID: 1418

Registrar Abuse Contact Email:

Registrar Abuse Contact Phone:

Domain Status: clientDeleteProhibited
https://icann.org/epp#clientDeleteProhibited

Domain Status: clientTransferProhibited
https://icann.org/epp#clientTransferProhibited

Domain Status: clientUpdateProhibited
https://icann.org/epp#clientUpdateProhibited

Name Server:
ns1.oxotube.com

Name Server:
ns2.oxotube.com

DNSSEC: unsigned

URL of the ICANN Whois Inaccuracy Complaint Form:
https://www.icann.org/wicf/

>>> Last update of whois database: 2017-12-11T12:26:14Z <<<



For more information on Whois status codes, please visit
https://icann.org/epp



NOTICE:
The expiration date displayed in this record is the date the

registrar's sponsorship of the domain name registration in the registry is

currently set to expire. This date does not necessarily reflect the expiration

date of the domain name registrant's agreement with the sponsoring

registrar. Users may consult the sponsoring registrar's Whois database to

view the registrar's reported date of expiration for this registration.



TERMS OF USE:
You are not authorized to access or query our Whois

database through the use of electronic processes that are high-volume and

automated except as reasonably necessary to register domain names or

modify existing registrations; the Data in VeriSign Global Registry

Services' ("VeriSign") Whois database is provided by VeriSign for

information purposes only, and to assist persons in obtaining information

about or related to a domain name registration record. VeriSign does not

guarantee its accuracy. By submitting a Whois query, you agree to abide

by the following terms of use: You agree that you may use this Data only

for lawful purposes and that under no circumstances will you use this Data

to:
(1) allow, enable, or otherwise support the transmission of mass

unsolicited, commercial advertising or solicitations via e-mail, telephone,

or facsimile; or (2) enable high volume, automated, electronic processes

that apply to VeriSign (or its computer systems). The compilation,

repackaging, dissemination or other use of this Data is expressly

prohibited without the prior written consent of VeriSign. You agree not to

use electronic processes that are automated and high-volume to access or

query the Whois database except as reasonably necessary to register

domain names or modify existing registrations. VeriSign reserves the right

to restrict your access to the Whois database in its sole discretion to ensure

operational stability. VeriSign may restrict or terminate your access to the

Whois database for failure to abide by these terms of use. VeriSign

reserves the right to modify these terms at any time.



The Registry database contains ONLY .COM, .NET, .EDU domains and

Registrars.

Front Page Thumbnail

sponsored links:

Front Page Loading Time

Keyword Hits (Biger,better)

Other TLDs of kinkygonzo

TLDs Created Expires Registered
.com
.net
.org
.cn
.com.cn
.asia
.mobi

Similar Websites

More...
Alexa鏍囬

Search Engine Spider Emulation

Title:Kinky Gonzo Tube : Free Porn Videos : Private Sex Movies : XXX Anal and Big Tits Show
Description:Kinky Gonzo is the newest porn tube that is fully dedicated to high-quality free porn videos. We've done much work to gather only the most exciting exclusive sex movies and xxx videos from all over the Net to add them to our frequently updated porn archive!
Keywords:kinky gonzo, sex tube, porn tube, free porn, anal videos, amateur fuck, hardcore clips, xhamster, pornhub, asian films
Body:
Kinky Gonzo Tube : Free Porn Videos : Private Sex Movies : XXX Anal and Big Tits Show
Kinky Gonzo Tube is the newest porn tube that is fully dedicated to high-quality free porn videos. We've done much work to gather only the most exciting exclusive amateur movies and anal xvideos from all over the Net to add them to our frequently updated xxx archive! You won't find here sex movies you've already seen on dozens of other porn tubes. Only the freshest high-quality sex videos for free. You shouldn't pay for porn anymore!
Date
-any date-TodayYesterday2 days ago3 days ago4 days ago5 days ago6 days agoLast WeekWeek Ago
Dur
-any len-0..5 minutes5..20 minutes20..40 minutes40..60 minutes60..90 minutes gt; 90 minutes
Tube
-any tube-aShemaleTubebigXvideosDrTuberHardsextubeHDpornOverThumbsPornerBrosPornHubRedTubeSunPornoTube8VID2CXhamsterXVideosXXXKinKyYobtYouPorn
Age
-all ages-18 year old19 year olddadgrannyinnocentmaturemilfmommothernunschoolgirlsisterteenuniversityvirginyoung
Country
-all countries-africanamericanargentinianbrazilianbritishchinesecubanczechdutchegyptianfilipinafinnishfrenchgermangreekhawaiianindianindonesianitalianjapanesekoreanmexicanpakistanipolishrussianspanishswedishthaiturkish
Teen
695707 Teen Tube Videos
Mature
363324 Mature Tube Videos
Wife
58139 Wife Tube Videos
First Time
28618 First Time Tube Videos
Indian
13922 Indian Tube Videos
Anal
354082 Anal Tube Videos
Japanese
103200 Japanese Tube Videos
Forced
2868 Forced Tube Videos
Young
99565 Young Tube Videos
Sleeping
2078 Sleeping Tube Videos
Classic
9718 Classic Tube Videos
Old Young
29964 Old Young Tube Videos
Shemale
107815 Shemale Tube Videos
Big Black Cock
43729 Big Black Cock Tube Videos
Babe
450836 Babe Tube Videos
Public
182608 Public Tube Videos
Milf
186885 Milf Tube Videos
Housewife
17705 Housewife Tube Videos
Massage
56714 Massage Tube Videos
Italian
9169 Italian Tube Videos
Ass
294982 Ass Tube Videos
Office
16252 Office Tube Videos
Maid
5512 Maid Tube Videos
Mature Amateur
96321 Mature Amateur Tube Videos
Lesbian
201601 Lesbian Tube Videos
3some
146200 3some Tube Videos
Double Fucking
9161 Double Fucking Tube Videos
Outdoor
86554 Outdoor Tube Videos
Huge Cock
73609 Huge Cock Tube Videos
Nun
706 Nun Tube Videos
Bizarre
25211 Bizarre Tube Videos
Old Man
8539 Old Man Tube Videos
Cuckold
28239 Cuckold Tube Videos
Russian
62217 Russian Tube Videos
Gangbang
38270 Gangbang Tube Videos
Orgasm
54774 Orgasm Tube Videos
Compilation
19368 Compilation Tube Videos
German
26421 German Tube Videos
Home Made
83539 Home Made Tube Videos
Game
10830 Game Tube Videos
Cheating
6135 Cheating Tube Videos
Bdsm
153365 Bdsm Tube Videos
Husband
5680 Husband Tube Videos
Teacher
15930 Teacher Tube Videos
Voyeur
111215 Voyeur Tube Videos
Story
3666 Story Tube Videos
Babysitter
5260 Babysitter Tube Videos
Bus
4149 Bus Tube Videos
Kinky
36393 Kinky Tube Videos
Hairy
111266 Hairy Tube Videos
Cartoon
13518 Cartoon Tube Videos
Feminization
1965 Feminization Tube Videos
Doctor
8878 Doctor Tube Videos
Cum In Mouth
21132 Cum In Mouth Tube Videos
Surprise
2486 Surprise Tube Videos
Mature Lesbian
39126 Mature Lesbian Tube Videos
Party
72589 Party Tube Videos
Bbw
146692 Bbw Tube Videos
Casting
22443 Casting Tube Videos
Arabian
8570 Arabian Tube Videos
Creampie
70110 Creampie Tube Videos
Natural Boobs
13655 Natural Boobs Tube Videos
African
12188 African Tube Videos
Jerking
45504 Jerking Tube Videos
Asian Teen
39907 Asian Teen Tube Videos
Hidden Cam
35136 Hidden Cam Tube Videos
Hd
101263 Hd Tube Videos
Vintage
35062 Vintage Tube Videos
Big Natural Tits
19465 Big Natural Tits Tube Videos
Anal Fisting
13366 Anal Fisting Tube Videos
Strap On
59144 Strap On Tube Videos
Monster Cock
10697 Monster Cock Tube Videos
Amateur
729011 Amateur Tube Videos
Mature Teacher
3091 Mature Teacher Tube Videos
Interracial
150515 Interracial Tube Videos
Seduce
17569 Seduce Tube Videos
Egyptian
621 Egyptian Tube Videos
Tranny
129662 Tranny Tube Videos
Busty
129419 Busty Tube Videos
Big Ass
118559 Big Ass Tube Videos
Chubby
24669 Chubby Tube Videos
Perverted
20076 Perverted Tube Videos
Swinger
11045 Swinger Tube Videos
Cash
8240 Cash Tube Videos
Sex
565938 Sex Tube Videos
Gay
265857 Gay Tube Videos
Bondage
38072 Bondage Tube Videos
Cumshot
200251 Cumshot Tube Videos
18 Year Old
22734 18 Year Old Tube Videos
Squirt
21587 Squirt Tube Videos
Anal Creampie
20603 Anal Creampie Tube Videos
British
19480 British Tube Videos
College Girl
57130 College Girl Tube Videos
Bisexual
27714 Bisexual Tube Videos
Hospital
2577 Hospital Tube Videos
Midget
1084 Midget Tube Videos
Cinema
389 Cinema Tube Videos
Big Cock
260627 Big Cock Tube Videos
Czech
12350 Czech Tube Videos
Chinese
9096 Chinese Tube Videos
Group Sex
272859 Group Sex Tube Videos
Cum
214478 Cum Tube Videos
Beauty
108653 Beauty Tube Videos
Latina
105086 Latina Tube Videos
Hentai
20262 Hentai Tube Videos
Beach
11263 Beach Tube Videos
Turkish
3800 Turkish Tube Videos
Pain
3358 Pain Tube Videos
Army
902 Army Tube Videos
Student
49504 Student Tube Videos
Deepthroat
42288 Deepthroat Tube Videos
Crazy
21619 Crazy Tube Videos
19 Year Old
11525 19 Year Old Tube Videos
Animation
11084 Animation Tube Videos
Oldy
5224 Oldy Tube Videos
Old Farts
1925 Old Farts Tube Videos
Pakistani
586 Pakistani Tube Videos
Hardcore
751675 Hardcore Tube Videos
Tits
525151 Tits Tube Videos
Pussy
363431 Pussy Tube Videos
Slave
22050 Slave Tube Videos
French
15967 French Tube Videos
Kitchen
9292 Kitchen Tube Videos
Retro
3444 Retro Tube Videos
Hermaphrodite
152 Hermaphrodite Tube Videos
Fetish
677288 Fetish Tube Videos
Cute
88755 Cute Tube Videos
Petite
44849 Petite Tube Videos
Panties
30728 Panties Tube Videos
Spy
10919 Spy Tube Videos
Thai
6894 Thai Tube Videos
Milk
6108 Milk Tube Videos
Forest
2781 Forest Tube Videos
Rocco
1633 Rocco Tube Videos
Asian
220889 Asian Tube Videos
Couple
205345 Couple Tube Videos
Ebony
199145 Ebony Tube Videos
Lesbian Teen
51471 Lesbian Teen Tube Videos
Skinny
40998 Skinny Tube Videos
Femdom
38547 Femdom Tube Videos
Fisting
22961 Fisting Tube Videos
Barely Legal
18789 Barely Legal Tube Videos
Car
14766 Car Tube Videos
Nurse
10006 Nurse Tube Videos
Big Nipples
7500 Big Nipples Tube Videos
American
5302 American Tube Videos
Filipina
2071 Filipina Tube Videos
Farm
671 Farm Tube Videos
Blowjob
1079895 Blowjob Tube Videos
Masturbating
366813 Masturbating Tube Videos
Black
169089 Black Tube Videos
Webcam
123652 Webcam Tube Videos
Handjob
95553 Handjob Tube Videos
Small Tits
59479 Small Tits Tube Videos
Close up
42203 Close up Tube Videos
Nudist
18609 Nudist Tube Videos
Brazilian
14577 Brazilian Tube Videos
Prostitute
14433 Prostitute Tube Videos
Crossdressing
11800 Crossdressing Tube Videos
Mexican
3635 Mexican Tube Videos
Swedish
2811 Swedish Tube Videos
Double Fisting
721 Double Fisting Tube Videos
Indonesian
466 Indonesian Tube Videos
Fucking
725026 Fucking Tube Videos
Girl
416917 Girl Tube Videos
Pornstar
129837 Pornstar Tube Videos
Stockings
75418 Stockings Tube Videos
Orgy
48051 Orgy Tube Videos
Clit
34908 Clit Tube Videos
Oriental
27586 Oriental Tube Videos
Cum Swallowing
20565 Cum Swallowing Tube Videos
Upskirt
15139 Upskirt Tube Videos
Anime
11798 Anime Tube Videos
Fat Mature
7973 Fat Mature Tube Videos
Old Young Lesbian
2627 Old Young Lesbian Tube Videos
Stewardess
465 Stewardess Tube Videos
Comic
366 Comic Tube Videos
Big Tits
413393 Big Tits Tube Videos
Solo
134640 Solo Tube Videos
Reality
78573 Reality Tube Videos
Fat Teen
14940 Fat Teen Tube Videos
Nympho
7649 Nympho Tube Videos
Monster Tits
7506 Monster Tits Tube Videos
Korean
5744 Korean Tube Videos
Plump Teen
4227 Plump Teen Tube Videos
Ugly
1210 Ugly Tube Videos
Saggy Tits
1183 Saggy Tits Tube Videos
Lactating
851 Lactating Tube Videos
Blonde
346838 Blonde Tube Videos
Fat
42370 Fat Tube Videos
Jizz
40712 Jizz Tube Videos
Date
-any date-TodayYesterday2 days ago3 days ago4 days ago5 days ago6 days agoLast WeekWeek Ago
Dur
-any len-0..5 minutes5..20 minutes20..40 minutes40..60 minutes60..90 minutes gt; 90 minutes
Tube
-any tube-aShemaleTubebigXvideosDrTuberHardsextubeHDpornOverThumbsPornerBrosPornHubRedTubeSunPornoTube8VID2CXhamsterXVideosXXXKinKyYobtYouPorn
Age
-all ages-18 year old19 year olddadgrannyinnocentmaturemilfmommothernunschoolgirlsisterteenuniversityvirginyoung
Country
-all countries-africanamericanargentinianbrazilianbritishchinesecubanczechdutchegyptianfilipinafinnishfrenchgermangreekhawaiianindianindonesianitalianjapanesekoreanmexicanpakistanipolishrussianspanishswedishthaiturkish
Today top searches
Search
. African black
. Amateur wife interracial
. Brother sister anal
. Caught
. Caught mom
. Celebrity
. Daddy
. Desi anal
. Drunk mature mom
. Family
. Father daughter
. Feet
. Filipina nipples
. Forced rape firsttime
. Fuck my wife
. Gangbang monster cock
. German
. Hd 1080
. Hidden cam massage
. Horse dildo
. Israeli
. Italian
. Japan mother son
. Japanese forced
. Lesbian mom daughter
. Mature
. Mature lesbian anal
. Mom
. Mom son
. Next to
. Old woman
. Petite filipina
. Petite solo
. Pissing
. Rough teen anal
. Schoolgirl force
. Sister
. Spy piss wc
. Sri lanka
. Taboo

Free Porn Videos
Today top tube Pornstars listing
Search
A
B
C
D
E
F
G
H
I
J
K
L
M
N
O
P
Q
R
S
T
U
V
W
X
Y
Z
. Addison Avery
. Akari Asagiri
. Ami Jordan
. Ana Nova
. Aninha
. Anna Skye
. Ayano
. Brynn
. Chloe
. Dominno Rebelde
. Eve Angels
. Face Fucking
. Holly Hunter
. Jay Ashley
. Jennifer Red
. Justine Joli
. Kate Beckinsale
. Kitsune
. Leanni Lei
. Lisa Thatcher
. Maddy Oreilly
. Mercy Starr
. Midori
. Nessa Devil
. Porscha Blaze
. Raven Vixen
. Richie
. Sasha Yung
. Satine Diamond
. Sonja Red
. Stacy Burke
. Taryn Thomas
. Vickie
. Whitney Wonders
. Yu Sakura

A
B
C
D
E
F
G
H
I
J
K
L
M
N
O
P
Q
R
S
T
U
V
W
X
Y
Z
Free Pornstar Videos
Top List of Porn Tube Sites
1-40
01 Xxx Sex Anal
02 My Xxx Movies
03 Latin Tube Porn
04 X Hamster Hq
05 Stream ViD
06 Hot Milf Clips
07 Video One
08 41 XXX Tube
09 Gonzo Xxx Movies
10 Redtube Porn
11 Best Sex Tube
12 Arion Porn Movies
13 Anal Sex Tube
14 Perfect Mums
15 Free Sex Videos
16 Wife Porno Movies
17 Mobile Tube Xxx
18 Free Naked Mature
19 Paris Tube Porn
20 Xxx Matures Tube
21 Free Xxx Tube
22 Hard Porn
23 Hard Amateur Porno
24 Xhamster Porn
25 Youporn.com
26 Hot Fuck Films
27 DT Video
28 Mature Videos Porn
29 Outdoors Sex Videos
30 Amateur Fuck Tubes
31 Hidden Cam Porn
32 Qoq Porn Tube
33 Beeg Porn Tube
34 Full Xxx Tube
35 Mommy Fuck Tube
36 Tube Mayor
37 On Movs
38 Xxx Fuck Porn
39 Dino Tube
40 Hard Porn
41-80
41 Stream Fuck
42 Wow Fuck Tube
43 Xxx Fuck Sex
44 Free Amateur Porn
45 Homemade Sex
46 World Porn Movies
47 Free Sex Xxx
48 Honey Porn Tube
49 Hardcore Xxx Tube
50 Japan Hd Porn
51 Free Hd Porn
52 Tube Porno Sex
53 Best Hardcore Sex
54 Anal Sex Films
55 Dirty Mom Porn
56 Japanese Fuck Movies
57 Mobile Xxx Porn
58 Xxx Mature Videos
59 Porn I Wank
60 Fuck Porn Xxx
61 Mature Sex Clips
62 Free Mature Anal
63 Free Pornstars Top
64 Indian Porno Tube
65 Mature Tube Fuck
66 Thai Tube Sex
67 Moms Xxx Movies/
68 Free Latin Porn
69 Forbidden Porno
70 Free Xxx Cam
71 Hd Sex Tubes
72 Fresh Asian Porn
73 Matures Nude Tube
74 Mom Xxx Videos
75 Xhamster
76 Milf Fuck
77 Brown Porn Tube
78 Xxx Tube Movies
79 Hq Sex Tubes
80 Sex Tube Videos
81-120
81 24x7 Porn Tube
82 Free Sex Tube
83 Beez Tube
84 Dirty Amateur Tube
85 Whores Tube
86 Xxx Videos
87 Fuck Anal Tube
88 Sex Tube Club
89 Sfico
90 Pink Dino
91 Mag Post
92 Spy Videos Tubes
93 Latina Fuck Tube
94 Classic Fuck Tube
95 Hardsextube
96 Hardsextube Porn
97 Free Fuck Mom
98 Mommy Porno Videos
99 Free Classic Porn
100 Free Moms Sex
101 Matures Fuck Tube
102 Free Sex Party
103 Try Free Porn
104 Fat Fuck Xxx
105 Free Xxx Movies
106 Oral Sex Movies
107 Mom Fuck Video
108 Big Sex Videos
109 White Porn Tube
110 Wife Porn Tube
111 Mom Tube Sex
112
113
114
115
116
117
118
119
120
121-160
121
122
123
124
125
126
127
128
129
130
131
132
133
134
135
136
137
138
139
140
141
142
143
144
145
146
147
148
149
150
151
152
153
154
155
156
157
158
159
160
161-200
161
162
163
164
165
166
167
168
169
170
171
172
173
174
175
176
177
178
179
180
181
182
183
184
185
186
187
188
189
190
191
192
193
194
195
196
197
198
199
200
We do not own, produce or host the videos displayed on this website.
All of the videos displayed here are hosted by websites that are not under our control
Best Sex l Abuse l

Updated Time

Updating   
Friend links: ProxyFire    More...
Site Map 1 2 3 4 5 6 7 8 9 10 20 30 40 50 60 70 80 90 100 110 120 130 140 150 160 170 180 190 200 250 300 350 400 450 500 550 600 610 620 630 640 650 660 670 680 690 700 710 720 730 740 750
TOS | Contact us
© 2009 MyIP.cn Dev by MYIP Elapsed:72.121ms