INSERT INTO sites(host) VALUES('kinkygonzo.com') 1045: Access denied for user 'www-data'@'localhost' (using password: NO) kinkygonzo.com Estimated Worth $106,307 - MYIP.NET Website Information
Welcome to MyIP.net!
 Set MYIP as homepage      

  
           

Web Page Information

Title:
Meta Description:
Meta Keywords:
sponsored links:
Links:
Images:
Age:
sponsored links:

Traffic and Estimation

Traffic:
Estimation:

Website Ranks

Alexa Rank:
Google Page Rank:
Sogou Rank:
Baidu Cache:

Search Engine Indexed

Search EngineIndexedLinks
 Google:
 Bing:
 Yahoo!:
 Baidu:
 Sogou:
 Youdao:
 Soso:

Server Data

Web Server:
IP address:    
Location:

Registry information

Registrant:
Email:
ICANN Registrar:
Created:
Updated:
Expires:
Status:
Name Server:
Whois Server:

Alexa Rank and trends

Traffic: Today One Week Avg. Three Mon. Avg.
Rank:
PV:
Unique IP:

More ranks in the world

Users from these countries/regions

Where people go on this site

Alexa Charts

Alexa Reach and Rank

Whois data

Who is kinkygonzo.com at com.whois-servers.net

Domain Name: KINKYGONZO.COM

Registry Domain ID: 1517363132_DOMAIN_COM-VRSN

Registrar WHOIS Server: whois.evonames.com

Registrar URL:
http://www.danesconames.com

Updated Date: 2016-04-05T08:24:45Z

Creation Date: 2008-09-01T19:36:16Z

Registry Expiry Date: 2018-09-01T19:36:16Z

Registrar: Danesco Trading Ltd.

Registrar IANA ID: 1418

Registrar Abuse Contact Email:

Registrar Abuse Contact Phone:

Domain Status: clientDeleteProhibited
https://icann.org/epp#clientDeleteProhibited

Domain Status: clientTransferProhibited
https://icann.org/epp#clientTransferProhibited

Domain Status: clientUpdateProhibited
https://icann.org/epp#clientUpdateProhibited

Name Server:
ns1.oxotube.com

Name Server:
ns2.oxotube.com

DNSSEC: unsigned

URL of the ICANN Whois Inaccuracy Complaint Form:
https://www.icann.org/wicf/

>>> Last update of whois database: 2017-09-14T19:36:52Z <<<



For more information on Whois status codes, please visit
https://icann.org/epp



NOTICE:
The expiration date displayed in this record is the date the

registrar's sponsorship of the domain name registration in the registry is

currently set to expire. This date does not necessarily reflect the expiration

date of the domain name registrant's agreement with the sponsoring

registrar. Users may consult the sponsoring registrar's Whois database to

view the registrar's reported date of expiration for this registration.



TERMS OF USE:
You are not authorized to access or query our Whois

database through the use of electronic processes that are high-volume and

automated except as reasonably necessary to register domain names or

modify existing registrations; the Data in VeriSign Global Registry

Services' ("VeriSign") Whois database is provided by VeriSign for

information purposes only, and to assist persons in obtaining information

about or related to a domain name registration record. VeriSign does not

guarantee its accuracy. By submitting a Whois query, you agree to abide

by the following terms of use: You agree that you may use this Data only

for lawful purposes and that under no circumstances will you use this Data

to:
(1) allow, enable, or otherwise support the transmission of mass

unsolicited, commercial advertising or solicitations via e-mail, telephone,

or facsimile; or (2) enable high volume, automated, electronic processes

that apply to VeriSign (or its computer systems). The compilation,

repackaging, dissemination or other use of this Data is expressly

prohibited without the prior written consent of VeriSign. You agree not to

use electronic processes that are automated and high-volume to access or

query the Whois database except as reasonably necessary to register

domain names or modify existing registrations. VeriSign reserves the right

to restrict your access to the Whois database in its sole discretion to ensure

operational stability. VeriSign may restrict or terminate your access to the

Whois database for failure to abide by these terms of use. VeriSign

reserves the right to modify these terms at any time.



The Registry database contains ONLY .COM, .NET, .EDU domains and

Registrars.

Front Page Thumbnail

sponsored links:

Front Page Loading Time

Keyword Hits (Biger,better)

Other TLDs of kinkygonzo

TLDs Created Expires Registered
.com
.net
.org
.cn
.com.cn
.asia
.mobi

Similar Websites

More...
Alexa鏍囬

Search Engine Spider Emulation

Title:Kinky Gonzo Tube : Free Porn Videos : Private Sex Movies : XXX Anal and Big Tits Show
Description:Kinky Gonzo is the newest porn tube that is fully dedicated to high-quality free porn videos. We've done much work to gather only the most exciting exclusive sex movies and xxx videos from all over the Net to add them to our frequently updated porn archive!
Keywords:kinky gonzo, sex tube, porn tube, free porn, anal videos, amateur fuck, hardcore clips, xhamster, pornhub, asian films
Body:
Kinky Gonzo Tube : Free Porn Videos : Private Sex Movies : XXX Anal and Big Tits Show
Kinky Gonzo Tube is the newest porn tube that is fully dedicated to high-quality free porn videos. We've done much work to gather only the most exciting exclusive amateur movies and anal xvideos from all over the Net to add them to our frequently updated xxx archive! You won't find here sex movies you've already seen on dozens of other porn tubes. Only the freshest high-quality sex videos for free. You shouldn't pay for porn anymore!
Date
-any date-TodayYesterday2 days ago3 days ago4 days ago5 days ago6 days agoLast WeekWeek Ago
Dur
-any len-0..5 minutes5..20 minutes20..40 minutes40..60 minutes60..90 minutes gt; 90 minutes
Tube
-any tube-aShemaleTubebigXvideosDrTuberHardsextubeHDpornOverThumbsPornerBrosPornHubRedTubeSunPornoTube8VID2CXhamsterXVideosXXXKinKyYobtYouPorn
Age
-all ages-18 year old19 year olddadgrannyinnocentmaturemilfmommothernunschoolgirlsisterteenuniversityvirginyoung
Country
-all countries-africanamericanargentinianbrazilianbritishchinesecubanczechdutchegyptianfilipinafinnishfrenchgermangreekhawaiianindianindonesianitalianjapanesekoreanmexicanpakistanipolishrussianspanishswedishthaiturkish
Old Young
28974 Old Young Tube Videos
Teen
687035 Teen Tube Videos
Indian
13658 Indian Tube Videos
Mature
357989 Mature Tube Videos
Housewife
17618 Housewife Tube Videos
Forced
2848 Forced Tube Videos
Monster Cock
10646 Monster Cock Tube Videos
Sleeping
2029 Sleeping Tube Videos
Shemale
106234 Shemale Tube Videos
Japanese
102759 Japanese Tube Videos
Cheating
5932 Cheating Tube Videos
First Time
28045 First Time Tube Videos
Compilation
19027 Compilation Tube Videos
Story
3567 Story Tube Videos
Anal
350406 Anal Tube Videos
Babe
445709 Babe Tube Videos
Milf
183881 Milf Tube Videos
Wife
56930 Wife Tube Videos
Office
16082 Office Tube Videos
Teacher
15745 Teacher Tube Videos
Home Made
81922 Home Made Tube Videos
Ass
291972 Ass Tube Videos
Vintage
34664 Vintage Tube Videos
Old Farts
1925 Old Farts Tube Videos
Massage
56046 Massage Tube Videos
Bizarre
25158 Bizarre Tube Videos
Classic
9691 Classic Tube Videos
Old Man
8432 Old Man Tube Videos
Bus
4105 Bus Tube Videos
Big Natural Tits
18566 Big Natural Tits Tube Videos
Italian
9209 Italian Tube Videos
Nun
705 Nun Tube Videos
Big Black Cock
43228 Big Black Cock Tube Videos
German
25946 German Tube Videos
Lesbian
199788 Lesbian Tube Videos
Kinky
35843 Kinky Tube Videos
Doctor
8732 Doctor Tube Videos
Public
180594 Public Tube Videos
Creampie
68975 Creampie Tube Videos
Young
97926 Young Tube Videos
Gangbang
37938 Gangbang Tube Videos
Orgasm
54183 Orgasm Tube Videos
Feminization
1938 Feminization Tube Videos
3some
144964 3some Tube Videos
Pakistani
560 Pakistani Tube Videos
Bbw
145116 Bbw Tube Videos
Swinger
10898 Swinger Tube Videos
Babysitter
5198 Babysitter Tube Videos
Hidden Cam
34552 Hidden Cam Tube Videos
Tranny
127959 Tranny Tube Videos
Jerking
45080 Jerking Tube Videos
Perverted
20010 Perverted Tube Videos
Arabian
8143 Arabian Tube Videos
10+ Inch Cock
1788 10+ Inch Cock Tube Videos
Cumshot
197236 Cumshot Tube Videos
Casting
22195 Casting Tube Videos
Cuckold
27772 Cuckold Tube Videos
Masturbating
361622 Masturbating Tube Videos
Party
72156 Party Tube Videos
Cartoon
13472 Cartoon Tube Videos
Maid
5412 Maid Tube Videos
Pain
3348 Pain Tube Videos
Hairy
110306 Hairy Tube Videos
American
4939 American Tube Videos
Seduce
17277 Seduce Tube Videos
Gay
258269 Gay Tube Videos
Fisting
22625 Fisting Tube Videos
Big Tits
408126 Big Tits Tube Videos
Asian
218979 Asian Tube Videos
Nurse
9957 Nurse Tube Videos
Mature Amateur
94730 Mature Amateur Tube Videos
Mature Lesbian
38771 Mature Lesbian Tube Videos
Bdsm
150899 Bdsm Tube Videos
Big Ass
117253 Big Ass Tube Videos
Boss
6045 Boss Tube Videos
Russian
61639 Russian Tube Videos
Squirt
21143 Squirt Tube Videos
Army
847 Army Tube Videos
Couple
204974 Couple Tube Videos
Asian Teen
39513 Asian Teen Tube Videos
Amateur
716147 Amateur Tube Videos
Beauty
107740 Beauty Tube Videos
18 Year Old
22695 18 Year Old Tube Videos
Surprise
2440 Surprise Tube Videos
Egyptian
551 Egyptian Tube Videos
Anal Creampie
20433 Anal Creampie Tube Videos
Natural Boobs
13340 Natural Boobs Tube Videos
Perky
32611 Perky Tube Videos
Brazilian
14408 Brazilian Tube Videos
African
11979 African Tube Videos
Fucking
720054 Fucking Tube Videos
Cash
8173 Cash Tube Videos
Interracial
148631 Interracial Tube Videos
Mature Teacher
3059 Mature Teacher Tube Videos
Cinema
387 Cinema Tube Videos
Hardcore
745763 Hardcore Tube Videos
Group Sex
270538 Group Sex Tube Videos
Big Cock
256316 Big Cock Tube Videos
Busty
128025 Busty Tube Videos
Outdoor
85488 Outdoor Tube Videos
French
15656 French Tube Videos
Czech
12238 Czech Tube Videos
Hospital
2558 Hospital Tube Videos
Handjob
93800 Handjob Tube Videos
Petite
44231 Petite Tube Videos
Hentai
20153 Hentai Tube Videos
Monster Tits
7483 Monster Tits Tube Videos
Husband
5588 Husband Tube Videos
Oldy
5216 Oldy Tube Videos
Pussy
360774 Pussy Tube Videos
Deepthroat
41703 Deepthroat Tube Videos
Skinny
40531 Skinny Tube Videos
Cum In Mouth
20705 Cum In Mouth Tube Videos
Beach
11075 Beach Tube Videos
Spy
10815 Spy Tube Videos
Thai
6794 Thai Tube Videos
Upskirt
14873 Upskirt Tube Videos
Turkish
3612 Turkish Tube Videos
Panties
30529 Panties Tube Videos
Bisexual
27483 Bisexual Tube Videos
Slave
21690 Slave Tube Videos
Cum Swallowing
20412 Cum Swallowing Tube Videos
British
19085 British Tube Videos
Gym
9426 Gym Tube Videos
Chinese
9020 Chinese Tube Videos
Old Young Lesbian
2575 Old Young Lesbian Tube Videos
Polish
1729 Polish Tube Videos
Ebony
196678 Ebony Tube Videos
Pornstar
128841 Pornstar Tube Videos
Game
10769 Game Tube Videos
Secretary
5274 Secretary Tube Videos
Mmf
5045 Mmf Tube Videos
Mexican
3480 Mexican Tube Videos
Rocco
1618 Rocco Tube Videos
Sex
562402 Sex Tube Videos
Voyeur
109134 Voyeur Tube Videos
Stockings
75055 Stockings Tube Videos
Lesbian Teen
50889 Lesbian Teen Tube Videos
Femdom
37834 Femdom Tube Videos
Small Cock
21118 Small Cock Tube Videos
Crossdressing
11783 Crossdressing Tube Videos
19 Year Old
11515 19 Year Old Tube Videos
Animation
11072 Animation Tube Videos
Filipina
2037 Filipina Tube Videos
Indonesian
449 Indonesian Tube Videos
Hermaphrodite
149 Hermaphrodite Tube Videos
Cum
211989 Cum Tube Videos
Webcam
119756 Webcam Tube Videos
Strap On
58922 Strap On Tube Videos
Student
49397 Student Tube Videos
Mistress
24456 Mistress Tube Videos
Chubby
24428 Chubby Tube Videos
Tgirl
17186 Tgirl Tube Videos
Car
14578 Car Tube Videos
Kitchen
9219 Kitchen Tube Videos
Retro
3358 Retro Tube Videos
Girl
414904 Girl Tube Videos
Black
167030 Black Tube Videos
Latina
103459 Latina Tube Videos
Hd
88754 Hd Tube Videos
Reality
77376 Reality Tube Videos
Small Tits
58480 Small Tits Tube Videos
Orgy
47739 Orgy Tube Videos
Fat
41935 Fat Tube Videos
Barely Legal
18780 Barely Legal Tube Videos
Anime
11764 Anime Tube Videos
Melons
10481 Melons Tube Videos
Fat Mature
7930 Fat Mature Tube Videos
Big Nipples
7316 Big Nipples Tube Videos
Milk
6022 Milk Tube Videos
Swedish
2800 Swedish Tube Videos
Midget
1068 Midget Tube Videos
Enema
691 Enema Tube Videos
Blowjob
1066280 Blowjob Tube Videos
Tits
518425 Tits Tube Videos
Flasher
28496 Flasher Tube Videos
Nudist
18352 Nudist Tube Videos
Prostitute
14386 Prostitute Tube Videos
Rimjob
11483 Rimjob Tube Videos
Korean
5691 Korean Tube Videos
Farm
663 Farm Tube Videos
Blonde
343875 Blonde Tube Videos
Solo
133661 Solo Tube Videos
Crazy
21556 Crazy Tube Videos
Nipples
17032 Nipples Tube Videos
Nympho
7608 Nympho Tube Videos
Cameltoe
1716 Cameltoe Tube Videos
Ugly
1200 Ugly Tube Videos
Prostate
1114 Prostate Tube Videos
Comic
367 Comic Tube Videos
Fat Teen
14844 Fat Teen Tube Videos
Date
-any date-TodayYesterday2 days ago3 days ago4 days ago5 days ago6 days agoLast WeekWeek Ago
Dur
-any len-0..5 minutes5..20 minutes20..40 minutes40..60 minutes60..90 minutes gt; 90 minutes
Tube
-any tube-aShemaleTubebigXvideosDrTuberHardsextubeHDpornOverThumbsPornerBrosPornHubRedTubeSunPornoTube8VID2CXhamsterXVideosXXXKinKyYobtYouPorn
Age
-all ages-18 year old19 year olddadgrannyinnocentmaturemilfmommothernunschoolgirlsisterteenuniversityvirginyoung
Country
-all countries-africanamericanargentinianbrazilianbritishchinesecubanczechdutchegyptianfilipinafinnishfrenchgermangreekhawaiianindianindonesianitalianjapanesekoreanmexicanpakistanipolishrussianspanishswedishthaiturkish
Today top searches
Search
. 60
. Abused facial
. African massage
. African pussy
. Alaina dawson
. Amateur
. Anal pee
. Backwards
. Big head cock
. Black women blowjob
. Blackzilla
. Casual teen
. Chubby teen amature
. Dad seduce
. Daisy
. Daughter impregnated
. Desi aunt
. Ebony hot
. Egypt porno
. Facesitting leggings
. Ghetto gaggers
. Grope stranger
. Hairy pissing
. Ivana
. Jan creampie
. Kinky law
. Lap dance lesbian
. Lesbian bdsm fisting
. Macri
. Mature amateur rough
. Max hardcore
. Muslim
. Nipple rub
. Office interracial sex
. Perverted gay
. Reagan foxx
. Real daughter dad
. Real first lesbian
. Redbone thick
. Young pretty

Free Porn Videos
Today top tube Pornstars listing
Search
A
B
C
D
E
F
G
H
I
J
K
L
M
N
O
P
Q
R
S
T
U
V
W
X
Y
Z
. Andrew
. Bianca Arden
. Brenda Lins
. Byron
. Carmen Electra
. Carter Cruise
. Cindy Jones
. Corina Curves
. Daisy Rock
. Danielle
. Eveline Neill
. Ginger Davis
. Jack Cummings
. Jesse Jane
. Jewels
. John West
. June Star
. Kat Young
. Kazue Yabuta
. Lina Ling
. Marsha
. Megumi Shino
. Mekeilah Love
. Olivia Saint
. Sabina
. Samantha Sterlying
. Sammie Sparks
. Santana
. Sasha Woman
. Sergio
. Shae Summers
. Temple
. Vanessa James

A
B
C
D
E
F
G
H
I
J
K
L
M
N
O
P
Q
R
S
T
U
V
W
X
Y
Z
Free Pornstar Videos
Top List of Porn Tube Sites
1-40
01 Xxx Sex Anal
02 Latin Tube Porn
03 Sex Tube Club
04 Free Sex Tube
05 Free Naked Mature
06 Video One
07 41 XXX Tube
08 Latina Fuck Tube
09 Hot Milf Clips
10 Wife Porno Movies
11 Paris Tube Porn
12 Stream ViD
13 Full Xxx Tube
14 X Hamster Hq
15 My Xxx Movies
16 Anal Sex Tube
17 Arion Porn Movies
18 Matures Fuck Tube
19 Hot Fuck Films
20 Spy Videos Tubes
21 Free Xxx Cam
22 Hard Amateur Porno
23 Granny Porn Videos
24 Hardsextube
25 Best Sex Tube
26 Homemade Sex
27 Free Classic Porn
28 DT Video
29 Mag Post
30 Pink Dino
31 Xxx Videos
32 Free Milf Ass
33 Sexy Xxx Babes
34 Oral Sex Movies
35 Beeg Porn Tube
36 Mature Videos Porn
37 Free Sex Porn
38 Xhamster
39 Free Xxx Movies
40 Fat Fuck Tube
41-80
41 Mature Tube Fuck
42 Matures Nude Tube
43 Mom Tube Sex
44 Bbw Fuck Videos
45 Suck Porn Tube
46 Amateur Fuck Tubes
47 Plumper Xxx Videos
48 Boobs Sex Videos
49 Beeg Tube
50 Penis Sex Movies
51 Ass Moms Porn
52 Xhamster Porn
53 Group Fuck Movies
54 Mature Sex Clips
55 Stream Sex Videos
56 Mature Wife Porn
57 Youporn.com
58 Honey Porn Tube
59 Gonzo Xxx Movies
60 World Porn Movies
61 Massage Xxx Movies
62 Mobile Tube Porn
63 Porn Tube Movies
64 Adult Movies
65 Perfect Mums
66 Mobile Tube Xxx
67 Anal Sex Tube
68 Anal Xxx Tube
69 Phone Porn Movies
70 Free Fuck Tube
71 Thai Tube Sex
72 Movs Porn Tube
73 Hot Free Xxx
74 Hd Sex Tubes
75 Free Xxx Tube
76 Xxx Hd Videos
77 U Xxx Tube
78 Fresh Asian Porn
79 All Fuck Tube
80 Dirty Mom Porn
81-120
81 Hq Sex Tubes
82 Sex Tube Videos
83 Fuck Tube Movies
84 Grow Porn Videos
85 Brown Xxx Tube
86 Sexy Hairy Women
87 Free Squirt Porno
88 Outdoors Sex Videos
89 Hd Porn Series
90 Extreme Fetish Videos
91 Best Hardcore Sex
92 Tube Porno Sex
93 Free Hairy Porno
94 Free Sex Videos
95 Massive Melons Porn
96 Hidden Cam Porn
97 Hq Porn Tubes
98 Free Sex Videos
99 Xxx Matures Tube
100 Forbidden Porno
101 Phone Tube Sex
102 Pussy Free Porn
103 Phone Porno Videos
104 Gangbang Sex Tube
105 69 Tube Porn
106 Mommy Porn Videos
107 Asian Mom Porn
108 Fuck Porn Xxx
109 Xxx Fuck Sex
110 Xxx Mature Pornstar
111 Japan Xxx Movies
112 Moms Xxx Movies/
113 Free Mature Porn
114 All Sex Tubes
115 Mom Sex Tubes
116 Free Korean Porn
117 Mature Free Sex
118 Indian Porno Tube
119 Granny Porn Clips
120 Free Mature Anal
121-160
121 Best Xxx Porn
122 Free Xxx Japanese
123 Free Xxx Porn
124 Xxx Mature Videos
125 Mobile Xxx Porn
126 Mobile Porno Tube
127 Older Woman Fuck
128 Japanese Fuck Movies
129 Wife Porn Tube
130 Jizz Tube Porn
131 Pornhub
132 Mom Xxx Videos
133 Mature Xxx Videos
134 Fuck Milf Porn
135 Mrs Sex Tube
136 Hard Porn
137 Milf Fuck
138 Brown Porn Tube
139 Wow Fuck Tube
140 Free Sex Videos
141 Xxx Tube Movies
142 Stream Fuck
143 Hard Porn
144 24x7 Porn Tube
145 Qoq Porn Tube
146 Sfico
147 On Movs
148 Fuck Anal Tube
149 Whores Tube
150 Dirty Amateur Tube
151 Beez Tube
152 Tube Mayor
153 GrannySex TubeZ
154 Xxx Fuck Porn
155 Dino Tube
156 Joker Sex Tube
157 Xxx Tube List
158 Fuck Tube Club
159 Sex Tube Sun
160 Free Sex Tube
161-200
161 Lucky Porno Tube
162 Sexy Asian Movies
163 Xxx Tube Clips
164 Xxx Tube Movies
165 Free Amateur Porn
166 Hard Spy Porn
167 Mixed Race Porn
168 Busty Lesbian Porn
169 Granny Xxx Films
170 Free Ebony Clips
171 Free Anal Tube
172 Classic Fuck Tube
173 Free Boobs Porn
174 Grow Sex Tube
175 Xvideos Porn
176 Hardsextube Porn
177 Fucking Movies
178 White Porn Tube
179 Xvideos Sex
180 Big Sex Videos
181 Mom Fuck Video
182 Free Porn Tubes
183 Mature Nude Porn
184 Redtube Porn
185 Fat Fuck Xxx
186 World Xxx Tube
187 Free Busty Porno
188 Top Fuck Tube
189 Try Free Porn
190 Free Sex Party
191 Free Moms Sex
192 Mommy Porno Videos
193 Moms Fuck
194 Free Fuck Mom
195
196
197
198
199
200
We do not own, produce or host the videos displayed on this website.
All of the videos displayed here are hosted by websites that are not under our control
Best Sex l Abuse l

Updated Time

Updating   
Friend links: ProxyFire    More...
Site Map 1 2 3 4 5 6 7 8 9 10 20 30 40 50 60 70 80 90 100 110 120 130 140 150 160 170 180 190 200 250 300 350 400 450 500 550 600 610 620 630 640 650 660 670 680 690 700 710 720 730 740 750
TOS | Contact us
© 2009 MyIP.cn Dev by MYIP Elapsed:170.801ms