INSERT INTO sites(host) VALUES('isiwebofknowledge.com') 1045: Access denied for user 'www-data'@'localhost' (using password: NO) isiwebofknowledge.com Estimated Worth $336,826 - MYIP.NET Website Information
Welcome to MyIP.net!
 Set MYIP as homepage      

  
           

Web Page Information

Title:
Meta Description:
Meta Keywords:
sponsored links:
Links:
Images:
Age:
sponsored links:

Traffic and Estimation

Traffic:
Estimation:

Website Ranks

Alexa Rank:
Google Page Rank:
Sogou Rank:
Baidu Cache:

Search Engine Indexed

Search EngineIndexedLinks
 Google:
 Bing:
 Yahoo!:
 Baidu:
 Sogou:
 Youdao:
 Soso:

Server Data

Web Server:
IP address:    
Location:

Registry information

Registrant:
Email:
ICANN Registrar:
Created:
Updated:
Expires:
Status:
Name Server:
Whois Server:

Alexa Rank and trends

Traffic: Today One Week Avg. Three Mon. Avg.
Rank:
PV:
Unique IP:

More ranks in the world

Users from these countries/regions

Where people go on this site

Alexa Charts

Alexa Reach and Rank

Whois data

Who is isiwebofknowledge.com at whois.markmonitor.com

Domain Name: isiwebofknowledge.com

Registry Domain ID: 58772607_DOMAIN_COM-VRSN

Registrar WHOIS Server: whois.markmonitor.com

Registrar URL: http://www.markmonitor.com

Updated Date: 2016-11-22T06:45:40-0800

Creation Date: 2001-02-07T09:00:38-0800

Registrar Registration Expiration Date: 2017-02-07T00:00:00-0800

Registrar: MarkMonitor, Inc.

Registrar IANA ID: 292

Registrar Abuse Contact Email: abusecomplaints

Registrar Abuse Contact Phone: +1.2083895740

Domain Status: clientUpdateProhibited (https://www.icann.org/epp#clientUpdateProhibited)

Domain Status: clientTransferProhibited (https://www.icann.org/epp#clientTransferProhibited)

Domain Status: clientDeleteProhibited (https://www.icann.org/epp#clientDeleteProhibited)

Registry Registrant ID:

Registrant Name: Domain Administrator

Registrant Organization: Thomson Reuters Global Resources

Registrant Street: Neuhofstrasse 1,

Registrant City: Baar

Registrant State/Province: Zug

Registrant Postal Code: 6340

Registrant Country: CH

Registrant Phone: +41.417090400

Registrant Phone Ext:

Registrant Fax: +41.417090400

Registrant Fax Ext:

Registrant Email: domain.name@thomsonreuters.com

Registry Admin ID:

Admin Name: Domain Administrator

Admin Organization: Thomson Reuters Global Resources

Admin Street: Neuhofstrasse 1,

Admin City: Baar

Admin State/Province: Zug

Admin Postal Code: 6340

Admin Country: CH

Admin Phone: +41.417090400

Admin Phone Ext:

Admin Fax: +41.417090400

Admin Fax Ext:

Admin Email: domain.name@thomsonreuters.com

Registry Tech ID:

Tech Name: Domain Administrator

Tech Organization: Thomson Reuters Global Resources

Tech Street: Neuhofstrasse 1,

Tech City: Baar

Tech State/Province: Zug

Tech Postal Code: 6340

Tech Country: CH

Tech Phone: +41.417090400

Tech Phone Ext:

Tech Fax: +41.417090400

Tech Fax Ext:

Tech Email: domain.name@thomsonreuters.com

Name Server: ns-amers-1.thomsonreuters.net

Name Server: ns-apac-2.thomsonreuters.net

Name Server: ns-apac-1.thomsonreuters.net

Name Server: ns-emea-2.thomsonreuters.net

Name Server: ns-amers-2.thomsonreuters.net

Name Server: ns-emea-1.thomsonreuters.net

DNSSEC: unsigned

URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/

>>> Last update of WHOIS database: 2016-12-26T21:40:58-0800 <<<



The Data in MarkMonitor.com's WHOIS database is provided by MarkMonitor.com for

information purposes, and to assist persons in obtaining information about or

related to a domain name registration record. MarkMonitor.com does not guarantee

its accuracy. By submitting a WHOIS query, you agree that you will use this Data

only for lawful purposes and that, under no circumstances will you use this Data to:

(1) allow, enable, or otherwise support the transmission of mass unsolicited,

commercial advertising or solicitations via e-mail (spam); or

(2) enable high volume, automated, electronic processes that apply to

MarkMonitor.com (or its systems).

MarkMonitor.com reserves the right to modify these terms at any time.

By submitting this query, you agree to abide by this policy.



MarkMonitor is the Global Leader in Online Brand Protection.



MarkMonitor Domain Management(TM)

MarkMonitor Brand Protection(TM)

MarkMonitor AntiPiracy(TM)

MarkMonitor AntiFraud(TM)

Professional and Managed Services



Visit MarkMonitor at http://www.markmonitor.com

Contact us at +1.8007459229

In Europe, at +44.02032062220



For more information on Whois status codes, please visit

https://www.icann.org/resources/pages/epp-status-codes-2014-06-16-en

Front Page Thumbnail

sponsored links:

Front Page Loading Time

Keyword Hits (Biger,better)

Other TLDs of isiwebofknowledge

TLDs Created Expires Registered
.com
.net
.org
.cn
.com.cn
.asia
.mobi

Similar Websites

More...
Alexa鏍囬

Search Engine Spider Emulation

Title:Clarivate Analytics - Web Of Science
Description:You need to find, analyze, and share high-quality, multidisciplinary scientific information quickly and easily. And you need the process to be seamless. That鈥檚 what you get with Web of Science™ 鈥 the world鈥檚 leading source of scholarly research data.
Keywords:
Body:
Clarivate Analytics - Web Of Science
This page needs JavaScript activated to work.
Webcast
Web of Science Item Level Usage Counts
Emerging Sources Citation Index
State of Innovation
Top 100 Innovators
The world鈥檚 100 most innovative organizations.
Read more 
Government Academic Research
Web of Science
InCites
Journal Citation Reports
Essential Science Indicators
Converis
Web of Science Profiles
Web of ScienceAuthor Connect
ScholarOne
EndNote
EndNote Site License
G A Professional Services
Intellectual Property
Thomson Innovation
Derwent
Thomson Data Analyzer
Thomson IP Manager
IP Payments
Patent Search Services
IP Administrative Services
Patent Preparation Prosecution
IP Analytics Services
Patent Translation Services
Patent Licensing Services
File Histories
Techstreet
Techstreet Enterprise
Virtual IP Office
Life Sciences
BioWorld
Cortellis Informatics
Cortellis Regulatory Intelligence
Cortellis Competitive Intelligence
Cortellis Clinical Trials Intelligence
Incidence and Prevalence Database
Integrity
Life Sciences Professional Services
Medical Device Daily
MetaCore and Key Pathway Advisor
Newport Premium
Precision Medicine Intelligence
Recap
BLOGS
Life Sciences Connect
IP Solutions
Science Research Connect
MarkMonitor
Thomson CompuMark
BRAND PROTECTION
MarkMonitor
Thomson CompuMark
Project Neon Project Neon
OUR POLICY TOWARDS THE USE OF COOKIES
All Clarivate Analytics websites use cookies to improve your online experience. They were placed on your computer when you launched this website. You can change your cookie settings through your browser.
Okay to continue
Cookie Policy
Intellectual Property Science is now known as Clarivate Analytics, and is no longer part of Thomson Reuters 禄
Clarivate Analytics
Formerly the IP amp; Sciencebusiness of Thomson Reuters
Search for:
Toggle navigation
Home
Products #038; Services
Products #038; Services
Bioworld
Cortellis Clinical Trials Intelligence
Cortellis Competitive Intelligence
Cortellis Informatics
Cortellis Regulatory Intelligence
Converis
Derwent
EndNote
EndNote Site License
Essential Science Indicators
File Histories
G #038;A Professional Services
InCites
Incidence and Prevalence Database
Integrity
IP Administrative Services
IP Analytics Services
IP Payments
Journal Citation Reports
Life Sciences Professional Services
MarkMonitor
Medical Device Daily
MetaCore and Key Pathway Advisor
Newport Premium
Patent Preparation #038; Prosecution
Patent Licensing Services
Patent Search Services
Patent Translation Services
Precision Medicine Intelligence
Recap
ScholarOne
Techstreet
Techstreet Enterprise
Thomson CompuMark
Thomson Data Analyzer
Thomson Innovation
Thomson IP Manager
Virtual IP Office
Web Of Science
Web of Science Profiles
Web of Science Author Connect
About Us
What We Do
Executive Leadership
Contact Us
My Role
CEO/CSO
Head of Marketing
Head of IP
Head of IP Admin
Head of Research Admin
Head of Regulatory
Head of R #038;D
Head of Pharma Discovery
Head of Portfolio and Licensing
Head of Publishing
Librarian
Patent Attorney
Researcher
Standards Manager
Customer Care
Techstreet
Thomson IP Management
ScholarOne
All other products
Training
Global Sites
Australia
India
Japan
Korea
New Zealand
China
Southeast Asia
Taiwan
News
Blogs
Life Sciences Connect
IP Solutions
Science Research Connect
MarkMonitor
Thomson CompuMark
Share on:
mdash;
Web of Science鈩
The world鈥檚 most trusted citation index covering the leading scholarly literature
Intelligent results, brilliant connections
Search and discover the world鈥檚 most impactful scholarly journals and scientific research
Brochure
Intelligent results, brilliant connections
The Web of Science platform is the search and discovery choice for 7,000+ academic and research institutions, national governments, funding organizations, and publishing organizations in 100+ countries worldwide.
Find cover-to-cover indexing of the world鈥檚 most important research covering scholarly journals, books, proceedings, published data sets, and patents. This content is truly multidisciplinary and global in nature, originating from 80 different countries and in 32 languages.
Quick powerful access to the global research ecosystem, check it out!
p
Explore research and ideas from different disciplines around the world by leaping through more than 1 billion cited references.
Connect to the most impactful discoveries
Get unrivaled coverage of regional and subject-specific content, delivered via the largest discovery platform.
Search fast, see the context, and find hidden patterns
To deliver the most relevant and complete search results, Web of Science uses global citation navigation. The embedded analysis tools help you further refine your results, allowing you to understand the global impact of the sources and authors you uncover while making new connections and discoveries across all disciplines and regions.
With Web of Science you can:
Trace citations forward and backward in time to see influences and later developments
Discover related articles quickly
Identify top authors, institution鈥檚 and publishers in any given field
Trace the development of your area of study
鈥淲eb of Science and compatible tools like EndNote, make our research easier and ensure we continue to be on the forefront and leading edge of innovation.鈥
Web of Science Video Challenge Film 2016
p
Relevant, Quality Content
We offer unbiased metrics based on citation activity of the most impactful global and regional journals, books, and proceedings for the scholarly community. And we remain free from proprietary involvement. This objective evaluation and selection criteria ensures you get the most relevant content.
p
Read the brochure
Custom data extractions to inform your research
As you plan for your next research project, our experts can work with you to conduct in-depth data assessments and extractions from Web of Science. This means you will be able reliably analyze research landscapes, connect research to outcomes, and understand emerging topics and trends. No other data source can give you the same degree of certainty.
See why using Web of Science data makes a difference
Contact us
Please complete this form to help us route your request to the appropriate Sales team.
First Name*
Last Name*
Job Role*-- Please select --AccountantAdministratorAnalyst/ResearcherAssistantAttorney/LawyerBankerBrand ManagerBusiness Development ProfessionalCEO/CTO/President/Vice PresidentChief IP CounselConsultantContracts specialistCoordinatorDeanDepartment HeadDirectorDocketing ManagerEngineerGeneral CounselHead of IP AdministrationHead of R DHead of StrategyInventorIT managerLaw Firm PartnerLecturerLibrarian/Information ProfessionalLicensing professionalManagerMarketing ProfessionalMedical ProfessionalParalegal/Legal executivePatent Attorney or AgentPatent ExaminerPolicy Maker/Policy DirectorPortfolio ManagerPress/PR/Media ProfessionalProfessorProgram ManagerProvost/ChancellorPublisherPurchaserRegulatory Affairs ProfessionalResearch ScientistSalesStudentTechnical specialistTrademark Attorney or AgentTraining specialistVenture capitalistVice Chancellor
Organization Name*
Organization Type*-- Please select --AcademicBiotechnology/Life SciencesChemicalConstruction/Manufacturing/EngineeringE-Commerce/Internet/ComputingFinance/Banking/Accounting/Venture CapitalGovernment HealthcareInformation brokerInsurance/Real EstateLaw firmMedia/PublishingMedical Equipment/DevicesNon ProfitPatent Library/OfficePharmaceuticalSociety/Association/NGOOther - to be determined
City*
Country*-- Please select --AUSTRALIAUSAUNITED KINGDOMCANADAJAPANFRANCEGERMANYNEW ZEALAND---------------------------------------AFGHANISTAN脜LAND ISLANDSALBANIAALGERIAAMERICAN SAMOAANDORRAANGOLAANGUILLAANTARCTICAANTIGUA AND BARBUDAARGENTINAARMENIAARUBAAUSTRIAAZERBAIJANBAHAMASBAHRAINBANGLADESHBARBADOSBELARUSBELGIUMBELIZEBENINBERMUDABHUTANBOLIVIABOSNIA AND HERZEGOVINABOTSWANABOUVET ISLANDBRAZILBRITISH INDIAN OCEAN TERRITORYBRUNEI DARUSSALAMBULGARIABURKINA FASOBURUNDICAMBODIACAMEROONCANADACAPE VERDECAYMAN ISLANDSCENTRAL AFRICAN REPUBLICCHADCHILECHINACHRISTMAS ISLANDCOCOS (KEELING) ISLANDSCOLOMBIACOMOROSCONGOCONGO, THE DEMOCRATIC REPUBLIC OF THECOOK ISLANDSCOSTA RICAC脭TE D'IVOIRECROATIACUBACYPRUSCZECH REPUBLICDENMARKDJIBOUTIDOMINICADOMINICAN REPUBLICECUADOREGYPTEL SALVADOREQUATORIAL GUINEAERITREAESTONIAETHIOPIAFALKLAND ISLANDS (MALVINAS)FAROE ISLANDSFIJIFINLANDFRANCEFRENCH GUIANAFRENCH POLYNESIAFRENCH SOUTHERN TERRITORIESGABONGAMBIAGEORGIAGERMANYGHANAGIBRALTARGREECEGREENLANDGRENADAGUADELOUPEGUAMGUATEMALAGUERNSEYGUINEAGUINEA-BISSAUGUYANAHAITIHEARD ISLAND AND MCDONALD ISLANDSHOLY SEE (VATICAN CITY STATE)HONDURASHONG KONGHUNGARYICELANDINDIAINDONESIAIRAN, ISLAMIC REPUBLIC OFIRAQIRELANDISLE OF MANISRAELITALYJAMAICAJAPANJERSEYJORDANKAZAKHSTANKENYAKIRIBATIKOREA, DEMOCRATIC PEOPLE'S REPUBLIC OFKOREA, REPUBLIC OFKUWAITKYRGYZSTANLAO PEOPLE'S DEMOCRATIC REPUBLICLATVIALEBANONLESOTHOLIBERIALIBYAN ARAB JAMAHIRIYALIECHTENSTEINLITHUANIALUXEMBOURGMACAOMACEDONIA, THE FORMER YUGOSLAV REPUBLIC OFMADAGASCARMALAWIMALAYSIAMALDIVESMALIMALTAMARSHALL ISLANDSMARTINIQUEMAURITANIAMAURITIUSMAYOTTEMEXICOMICRONESIA, FEDERATED STATES OFMOLDOVA, REPUBLIC OFMONACOMONGOLIAMONTENEGROMONTSERRATMOROCCOMOZAMBIQUEMYANMARNAMIBIANAURUNEPALNETHERLANDSNETHERLANDS ANTILLESNEW CALEDONIANICARAGUANIGERNIGERIANIUENORFOLK ISLANDNORTHERN MARIANA ISLANDSNORWAYOMANPAKISTANPALAUPALESTINIAN TERRITORY, OCCUPIEDPANAMAPAPUA NEW GUINEAPARAGUAYPERUPHILIPPINESPITCAIRNPOLANDPORTUGALPUERTO RICOQATARREUNIONROMANIARUSSIAN FEDERATIONRWANDASAINT BARTH脡LEMYSAINT HELENASAINT KITTS AND NEVISSAINT LUCIASAINT MARTINSAINT PIERRE AND MIQUELONSAINT VINCENT AND THE GRENADINESSAMOASAN MARINOSAO TOME AND PRINCIPESAUDI ARABIASENEGALSERBIASEYCHELLESSIERRA LEONESINGAPORESLOVAKIASLOVENIASOLOMON ISLANDSSOMALIASOUTH AFRICASOUTH GEORGIA AND THE SOUTH SANDWICH ISLANDSSPAINSRI LANKASUDANSURINAMESVALBARD AND JAN MAYENSWAZILANDSWEDENSWITZERLANDSYRIAN ARAB REPUBLICTAIWANTAJIKISTANTANZANIA, UNITED REPUBLIC OFTHAILANDTIMOR-LESTETOGOTOKELAUTONGATRINIDAD AND TOBAGOTUNISIATURKEYTURKMENISTANTURKS AND CAICOS ISLANDSTUVALUUGANDAUKRAINEUNITED ARAB EMIRATESUNITED KINGDOMUNITED STATES OF AMERICAUNITED STATES MINOR OUTLYING ISLANDSURUGUAYUZBEKISTANVANUATUVENEZUELAVIET NAMVIRGIN ISLANDS, BRITISHVIRGIN ISLANDS, U.S.WALLIS AND FUTUNAWESTERN SAHARAYEMENZAMBIAZIMBABWE
State/Province*-- Select State --Outside North AmericaAlaskaAlabamaArkansasAmerican SamoaArizonaCaliforniaColoradoConnecticutD.C.DelawareFloridaMicronesiaGeorgiaGuamHawaiiIowaIdahoIllinoisIndianaKansasKentuckyLouisianaMassachusettsMarylandMaineMarshall IslandsMichiganMinnesotaMissouriMarianasMississippiMontanaNorth CarolinaNorth DakotaNebraskaNew HampshireNew JerseyNew MexicoNevadaNew YorkOhioOklahomaOregonPennsylvaniaPuerto RicoPalauRhode IslandSouth CarolinaSouth DakotaTennesseeTexasUtahVirginiaVirgin IslandsVermontWashingtonWisconsinWest VirginiaWyomingMilitary AmericasMilitary Europe/ME/CanadaMilitary PacificAlbertaManitobaBritish ColumbiaNew BrunswickNewfoundland and LabradorNova ScotiaNorthwest TerritoriesNunavutOntarioPrince Edward IslandQuebecSaskatchewanYukon Territory
Email Address*
Response required
We can only answer sales queries via this form, if you need product support or training please visit our Customer Support Center
View our privacy policy
Related Blog Posts
Ever wonder about the science behind your smartphone camera?a
Read more gt;
Effective product selection and partner identification within the Generics and Active Ingredient landscapea
Read more gt;
Webinar: Scholarly Publishing Insightsa
Read more gt;
copy; 2016 Clarivate Analytics
Cookie Policy
Privacy Statement
Terms of Use
Copyright
Careers
Share on:

Updated Time

Updating   
Friend links: ProxyFire    More...
Site Map 1 2 3 4 5 6 7 8 9 10 20 30 40 50 60 70 80 90 100 110 120 130 140 150 160 170 180 190 200 250 300 350 400 450 500 550 600 610 620 630 640 650 660 670 680 690 700 710 720 730 740 750
TOS | Contact us
© 2009 MyIP.cn Dev by MYIP Elapsed:72.899ms