INSERT INTO sites(host) VALUES('arionmovies.com') 1045: Access denied for user 'www-data'@'localhost' (using password: NO) arionmovies.com Estimated Worth $346,923 - MYIP.NET Website Information
Welcome to MyIP.net!
 Set MYIP as homepage      

  
           

Web Page Information

Title:
Meta Description:
Meta Keywords:
sponsored links:
Links:
Images:
Age:
sponsored links:

Traffic and Estimation

Traffic:
Estimation:

Website Ranks

Alexa Rank:
Google Page Rank:
Sogou Rank:
Baidu Cache:

Search Engine Indexed

Search EngineIndexedLinks
 Google:
 Bing:
 Yahoo!:
 Baidu:
 Sogou:
 Youdao:
 Soso:

Server Data

Web Server:
IP address:    
Location:

Registry information

Registrant:
Email:
ICANN Registrar:
Created:
Updated:
Expires:
Status:
Name Server:
Whois Server:

Alexa Rank and trends

Traffic: Today One Week Avg. Three Mon. Avg.
Rank:
PV:
Unique IP:

More ranks in the world

Users from these countries/regions

Where people go on this site

Alexa Charts

Alexa Reach and Rank

Whois data

Who is arionmovies.com at whois.enom.com





Domain Name:
ARIONMOVIES.COM

Registry Domain ID: 1256466428_DOMAIN_COM-VRSN

Registrar WHOIS Server: whois.enom.com

Registrar URL: www.enom.com

Updated Date: 2014-04-11T04:33:56.00Z

Creation Date: 2007-10-05T07:19:00.00Z

Registrar Registration Expiration Date: 2018-10-05T07:19:00.00Z

Registrar: ENOM, INC.

Registrar IANA ID: 48

Reseller: NAMECHEAP.COM

Domain Status: clientTransferProhibited https://www.icann.org/epp#clientTransferProhibited

Registry Registrant ID:

Registrant Name: JORDY PIETERS

Registrant Organization: N/A

Registrant Street: SERINGSTRAAT 18 APT. 9

Registrant City: EDERVEEN

Registrant State/Province: GELDERLAND

Registrant Postal Code: 6744 WZ

Registrant Country: NL

Registrant Phone: +31.1318571462

Registrant Phone Ext:

Registrant Fax:

Registrant Fax Ext:

Registrant Email: WEB

Registry Admin ID:

Admin Name: JORDY PIETERS

Admin Organization: N/A

Admin Street: SERINGSTRAAT 18 APT. 9

Admin City: EDERVEEN

Admin State/Province: GELDERLAND

Admin Postal Code: 6744 WZ

Admin Country: NL

Admin Phone: +31.1318571462

Admin Phone Ext:

Admin Fax:

Admin Fax Ext:

Admin Email: WEB

Registry Tech ID:

Tech Name: JORDY PIETERS

Tech Organization: N/A

Tech Street: SERINGSTRAAT 18 APT. 9

Tech City: EDERVEEN

Tech State/Province: GELDERLAND

Tech Postal Code: 6744 WZ

Tech Country: NL

Tech Phone: +31.1318571462

Tech Phone Ext:

Tech Fax:

Tech Fax Ext:

Tech Email: WEB

Name Server: ns1.fuckez.com

Name Server: ns2.fuckez.com

DNSSEC: unSigned

Registrar Abuse Contact Email: abuse@enom.com

Registrar Abuse Contact Phone: +1.4252982646

URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/

>>> Last update of WHOIS database: 2014-04-11T04:33:56.00Z <<<



For more information on Whois status codes, please visit https://icann.org/epp





The data in this whois database is provided to you for information

purposes only, that is, to assist you in obtaining information about or

related to a domain name registration record. We make this information

available "as is," and do not guarantee its accuracy. By submitting a

whois query, you agree that you will use this data only for lawful

purposes and that, under no circumstances will you use this data to: (1)

enable high volume, automated, electronic processes that stress or load

this whois database system providing you this information; or (2) allow,

enable, or otherwise support the transmission of mass unsolicited,

commercial advertising or solicitations via direct mail, electronic

mail, or by telephone. The compilation, repackaging, dissemination or

other use of this data is expressly prohibited without prior written

consent from us.



We reserve the right to modify these terms at any time. By submitting

this query, you agree to abide by these terms.

Version 6.3 4/3/2002

Front Page Thumbnail

sponsored links:

Front Page Loading Time

Keyword Hits (Biger,better)

Other TLDs of arionmovies

TLDs Created Expires Registered
.com
.net
.org
.cn
.com.cn
.asia
.mobi

Similar Websites

More...
Alexa鏍囬

Search Engine Spider Emulation

Title:Arion Movies . Com - Free Porn - Sex Tube
Description:Free porn and sex videos available absolutely free on Arion Movies. com! Enter the xxx world of unlimited homemade fuck videos, and you are sure to stay with us for hours!
Keywords:free porn, sex tube, xxx videos, anal sex, indian porn, asian movies
Body:
Arion Movies . Com - Free Porn - Sex Tube
Arion Porn Movies - great website full of never seen before xxx videos available absolutely free! We don't collect old hackneyed videos that you can easily find on any other free resources, but select only the most qualitative clips, which are sure to impress even the most discriminating sex fans. Enter the world of unlimited free porn, and you are sure to stay with us for hours!
Date
-any date-Yesterday2 days ago3 days ago4 days ago5 days agoLast Week6 days agoWeek Ago
Length
-any len-0..5 minutes5..20 minutes20..40 minutes40..60 minutes60..90 minutes gt; 90 minutes
Tube
-any tube-HardsextubeHDpornOverThumbsPornerBrosPornHubRedTubeSunPornoTube8VID2CXhamsterXVideosXXXKinKyYobtYouPorn
Age
-all ages-18 year old19 year olddadgrannyinnocentmaturemilfmommothernunschoolgirlsisterteenuniversityvirginyoung
Country
-countries-africanamericanargentinianbrazilianbritishchinesecubanczechdutchegyptianfilipinafinnishfrenchgermangreekhawaiianindianindonesianitalianjapanesekoreanmexicanpakistanipolishrussianspanishswedishthaiturkish
Teen
694481 Teen Tube Videos
Forced
3551 Forced Tube Videos
Mature
358221 Mature Tube Videos
Perverted
24037 Perverted Tube Videos
Japanese
99934 Japanese Tube Videos
Vintage
34165 Vintage Tube Videos
Big Cock
253362 Big Cock Tube Videos
Wife
59216 Wife Tube Videos
Classic
9950 Classic Tube Videos
18 Year Old
27095 18 Year Old Tube Videos
Lesbian
206071 Lesbian Tube Videos
Story
4089 Story Tube Videos
Home Made
95532 Home Made Tube Videos
Old Young
31281 Old Young Tube Videos
Anal
348143 Anal Tube Videos
Indian
13285 Indian Tube Videos
Amateur
716726 Amateur Tube Videos
Russian
66091 Russian Tube Videos
Shemale
60524 Shemale Tube Videos
Interracial
154944 Interracial Tube Videos
Milf
182739 Milf Tube Videos
Swinger
10915 Swinger Tube Videos
Arabian
7770 Arabian Tube Videos
German
25525 German Tube Videos
Italian
8512 Italian Tube Videos
Public
185285 Public Tube Videos
Massage
59139 Massage Tube Videos
Czech
12446 Czech Tube Videos
Retro
3525 Retro Tube Videos
Old Man
9686 Old Man Tube Videos
Housewife
19659 Housewife Tube Videos
Sleeping
2249 Sleeping Tube Videos
Hairy
122722 Hairy Tube Videos
Bizarre
31004 Bizarre Tube Videos
Hidden Cam
34146 Hidden Cam Tube Videos
Compilation
17517 Compilation Tube Videos
Orgasm
62896 Orgasm Tube Videos
Gangbang
39724 Gangbang Tube Videos
French
15477 French Tube Videos
Bus
4319 Bus Tube Videos
Casting
30778 Casting Tube Videos
Anime
11301 Anime Tube Videos
Handjob
102704 Handjob Tube Videos
Beach
11147 Beach Tube Videos
Cinema
412 Cinema Tube Videos
Cum In Mouth
32872 Cum In Mouth Tube Videos
Ass
298026 Ass Tube Videos
Seduce
18876 Seduce Tube Videos
Doctor
8612 Doctor Tube Videos
Creampie
73413 Creampie Tube Videos
Thai
6452 Thai Tube Videos
Nudist
18730 Nudist Tube Videos
Maid
5367 Maid Tube Videos
Cheating
5560 Cheating Tube Videos
Gay
267712 Gay Tube Videos
Cuckold
36033 Cuckold Tube Videos
Mature Amateur
93650 Mature Amateur Tube Videos
Bbw
154786 Bbw Tube Videos
Prostitute
25047 Prostitute Tube Videos
Asian
209223 Asian Tube Videos
Big Natural Tits
24989 Big Natural Tits Tube Videos
Masturbating
353309 Masturbating Tube Videos
Teacher
16257 Teacher Tube Videos
Ugly
1239 Ugly Tube Videos
Pornstar
135540 Pornstar Tube Videos
Fucking
769948 Fucking Tube Videos
Cash
9612 Cash Tube Videos
Bdsm
160991 Bdsm Tube Videos
Webcam
111312 Webcam Tube Videos
Husband
5652 Husband Tube Videos
Party
82841 Party Tube Videos
Monster Cock
14026 Monster Cock Tube Videos
Voyeur
110681 Voyeur Tube Videos
Outdoor
83304 Outdoor Tube Videos
Spy
11355 Spy Tube Videos
Surprise
2555 Surprise Tube Videos
Slave
24663 Slave Tube Videos
Game
12011 Game Tube Videos
Animation
11181 Animation Tube Videos
Car
15243 Car Tube Videos
Insertion
12205 Insertion Tube Videos
Prostate
1221 Prostate Tube Videos
Mature Lesbian
42162 Mature Lesbian Tube Videos
Stockings
70611 Stockings Tube Videos
Flasher
32720 Flasher Tube Videos
British
20425 British Tube Videos
Mmf
6382 Mmf Tube Videos
Rocco
1760 Rocco Tube Videos
Blowjob
1097879 Blowjob Tube Videos
Sex
612754 Sex Tube Videos
Tranny
73941 Tranny Tube Videos
Couple
222141 Couple Tube Videos
African
12323 African Tube Videos
Hermaphrodite
154 Hermaphrodite Tube Videos
Black
173163 Black Tube Videos
Nude
112183 Nude Tube Videos
Bisexual
44431 Bisexual Tube Videos
Chubby
25095 Chubby Tube Videos
Ebony
202013 Ebony Tube Videos
Dildo
108145 Dildo Tube Videos
Panties
35321 Panties Tube Videos
Cum Swallowing
31829 Cum Swallowing Tube Videos
3d
6547 3d Tube Videos
3some
147839 3some Tube Videos
Fisting
22125 Fisting Tube Videos
Orgy
60599 Orgy Tube Videos
Small Cock
22528 Small Cock Tube Videos
Whip
4952 Whip Tube Videos
Lesbian Teen
52105 Lesbian Teen Tube Videos
Spanked
15427 Spanked Tube Videos
Brazilian
14275 Brazilian Tube Videos
Screaming
2605 Screaming Tube Videos
Nun
718 Nun Tube Videos
Big Black Cock
45223 Big Black Cock Tube Videos
Chinese
10243 Chinese Tube Videos
Secretary
5274 Secretary Tube Videos
Old Young Lesbian
3715 Old Young Lesbian Tube Videos
Cum
234297 Cum Tube Videos
Latina
99278 Latina Tube Videos
Squirt
21197 Squirt Tube Videos
Turkish
3392 Turkish Tube Videos
Flexible
2867 Flexible Tube Videos
Golden Shower
2522 Golden Shower Tube Videos
Group Sex
282589 Group Sex Tube Videos
Big Ass
117443 Big Ass Tube Videos
Nipples
19040 Nipples Tube Videos
Filipina
1938 Filipina Tube Videos
Busty
134452 Busty Tube Videos
Missionary
27293 Missionary Tube Videos
Gloryhole
15610 Gloryhole Tube Videos
Upskirt
14573 Upskirt Tube Videos
Submissive
11324 Submissive Tube Videos
Kitchen
9718 Kitchen Tube Videos
Boss
6254 Boss Tube Videos
Tits
519885 Tits Tube Videos
Doggystyle
141412 Doggystyle Tube Videos
Solo
125548 Solo Tube Videos
Strap On
76910 Strap On Tube Videos
Transsexual
16232 Transsexual Tube Videos
DPed Anal
7277 DPed Anal Tube Videos
Swedish
2768 Swedish Tube Videos
Pussy
411728 Pussy Tube Videos
Big Tits
403576 Big Tits Tube Videos
Jerking
48248 Jerking Tube Videos
Deepthroat
45017 Deepthroat Tube Videos
Bondage
41168 Bondage Tube Videos
Gorgeous
37401 Gorgeous Tube Videos
Twins
1262 Twins Tube Videos
Beauty
119774 Beauty Tube Videos
Student
58031 Student Tube Videos
Anal Creampie
25037 Anal Creampie Tube Videos
Glasses
12935 Glasses Tube Videos
Rimjob
11806 Rimjob Tube Videos
Spanish
3700 Spanish Tube Videos
Mexican
3313 Mexican Tube Videos
Exhibitionists
2723 Exhibitionists Tube Videos
Saggy Tits
1011 Saggy Tits Tube Videos
Fetish
670638 Fetish Tube Videos
Pantyhose
18572 Pantyhose Tube Videos
Emo
8429 Emo Tube Videos
Fat Mature
7945 Fat Mature Tube Videos
Transvestite
7499 Transvestite Tube Videos
Forest
2994 Forest Tube Videos
Clothed Sex
2098 Clothed Sex Tube Videos
Greek
535 Greek Tube Videos
Egyptian
520 Egyptian Tube Videos
Sperm
54430 Sperm Tube Videos
Clit
48753 Clit Tube Videos
Femdom
41010 Femdom Tube Videos
Kinky
39112 Kinky Tube Videos
Glamour
38972 Glamour Tube Videos
Anus
20575 Anus Tube Videos
Office
16695 Office Tube Videos
Milk
6118 Milk Tube Videos
Pakistani
545 Pakistani Tube Videos
Alien
278 Alien Tube Videos
Doll
29834 Doll Tube Videos
Crossdressing
9463 Crossdressing Tube Videos
Hogtied
697 Hogtied Tube Videos
Enema
636 Enema Tube Videos
Pages: 1 2 3 4 5 ... 12826
Today top searches
Search
. Abnormal
. Accidently
. Amateur cum mouth
. Amateur fisting
. Amateur wife doggystyle
. Amature wife double penetration
. Asian ladyboy handjob
. Asian mom son
. Bbw raped
. Cap agde
. Celebrity orgasm
. Cuckold eating cum
. Eating mature pussy
. Forced interracial
. Forced sex young girls rape
. Gina gerson
. Grandpa granny
. Granny anal
. Hairy lesbian vintage
. Hidden cam milf
. Indian housewife
. Indian milk
. Indian nri
. Interracial slave
. Japanese family
. Kurde
. Leather gloves
. Maid granny
. Mature 50
. Mom abused
. Mom fucking son
. My wife hidden
. Pakistani gay
. Real defloration
. Serbian amateur
. Spanish
. Sri lanka
. Tamil indian
. Topless beach
. Young daughter destruction
Free porn videos
Hot Pornstars Fucking
Search
A
B
C
D
E
F
G
H
I
J
K
L
M
N
O
P
Q
R
S
T
U
V
W
X
Y
Z
. Amy Lee
. Anthony Martinez
. April Blue
. Cherrie
. Chloe Amour
. Hele Hendrich
. Italia Christie
. Jeanie Marie
. Josephine James
. Joy
. Juelz Ventura
. Julia Usova
. Katia Oliveira
. Kimber James
. Kyla Cole
. Kylie Rachel
. Lexi Hawk
. Mr Marcus
. Natalie Heck
. Oldman
. Patricia Araujo
. Petra Verkaik
. Renee Jordan
. Shai West
. Slut Jasmine
. Soraya
. Sugar
. Sunrise Adams
. Tara Lynn
. Tj
. Tomo Paradise
. Tsugumi
. Valeria Reis
. Victoria Rae Black
. Zdenka Podkapova
Top List of Porn Tube Sites
1-40
01Porno Rama
02Movie Mo
03Video One
04Sex Tube Fuck
05Rulertube
06Dildo Xxx Tube
07Nice Sex Tube
08DT Video
09Sfico
10New Sex TV
11Free Moms Sex
12Pink Dino
13Sex Tube Club
14My Xxx Movies
15Mag Post
16Video You Tube
17Stolen Wifes
18Place of Porn
19Mommy Sex Movies
20Kinky Gonzo Porn
21Sex Tube Films
22Dino Tube
23World Porn Movies
24Sexy Tuber Fuck
25Ice Porn
26Vintage Porn Videos
27May Be Porn
28Live Granny
29Mr Porn
30Xxx Sex Anal
31La Xxx Porn
32Sexy Sluts
33Car Tube Video
34Boss Video
3521 Pornhub
36Free Porn Tube
37XNXX Movies
38Suck Porn Tube
39Mature Videos Porn
40Paris Tube Porn
41-80
41Older Mom Tube
42Fuck Videos
43Wife Porno Movies
44Best Xxx Fuck
45Gonzo Movies
46Stream Sex
47Indian Porn Tube
48Cum Comes
49Cute Porn TV
50Hot Free Xxx
51Naked Boobs Porn
52Tapir Porn Tube
53Anal Sex Tube
54Crunk Movies
55Hot Sex Tube
56Porn Tube Archive
57Mom Tube Sex
58Cash Video Tube
59Xvideos Sex
60Hot Fuck Films
61Xhamster Porn
62Beeg Porn Tube
63Filth Matures
64Fuck Porn Xxx
65Xvideos Porn
66Mrs Sex Tube
67Hirsute Porn Legs
68Matures Naked
69Porn Tube Boobs
70Fat Fuck Tube
71Naked Wife Porn
72Bbw Fuck Videos
73Redtube Porn
74Moms Fuck
75Wow Fuck Tube
76World Xxx Tube
77Perfect Sex Movies
78Beeg Tube
79Hardsextube Porn
80XiX Porn Tube
81-120
81Mommy Porn Videos
82Sweet Girls Tube
83Kaza Porn Tube
84QoQ Tube
85Goblins Tube
86Dwarfs Tube
87Mobile Porno Tube
88My Retro Tube
89HuK Tube
90Live Porn Films
91Bush Pussy
92Diamond Tubes
93Porn Control
94Xxx Hd Videos
95Xxx Sex Fuck
96Free Milf Videos
97Free Sex Tube
98Pornesto
99Free Amateur Porn
100Ass Porno Tube
101Free Xxx Movies
102Fat Fuck Xxx
103Classic Fuck Tube
104African Xxx Movies
105Free Sex Porno
106Granny Porn Videos
107Free Sex Porn
108Hardsextube
109Top Fuck Tube
110Grow Sex Tube
111Try Free Porn
112Fucking Tube Xxx
113Porn Films Online
114Amateur Orgy Clips
115Matures Fuck Tube
116Hard Homemade Porn
117Hq Sex Video
118Hairy Porno Videos
119Hidden Cam Porn
120Voyeur Sex Films
121-160
121Hq Sex Tubes
122Hard Porn
123Brown Xxx Tube
124Home Private Vids
125KeX Tube
126Dads Sex Videos
127Xhamster
128Matures Nude Tube
129Pipe Porn Tube
130Pornhub
131Mature Nude Porn
132Boobs Sex Videos
133Free Sex Tube
134Youporn.com
135Jizz Tube Porn
136Best Sex Tube
137Flamingo Tube
138Old Women Porn
139Xxx Porn Videos
140Hq Moms Xxx
141Mature Anal Sex
142Granny Sex Movs
143Free Movies Xxx
144Sweet Milf Porn
145Hidden Cams Sex
146Stream Sex Porn
147Latina Tube Xxx
148Matures Free Xxx
149Free Xxx Housewife
150Mature Free Fuck
151Free Mature Porn
152Korean Porn Tube
153Korean Sex Movies
154Hq Sex Movies
155Mature Fuck Videos
156Real Asian Porn
157Vibrator Porn Tube
158Mature Free Porn
159Free Iphone Sex
160Amateur Videos Porn
161-200
161Warm Pussy Tube
162Wife Xxx Porn
163Pussy Secret Sex
164Live Porn Videos
165Xxx Mature Videos
166Mature Sex Clips
167Free Iphone Porn
168Japanese Sex Videos
169Best Porn Tube
170Moms Xxx Porn
171Hq Black Porn
172All Milf Porn
173Asian Free Porns
174Mature Free Porn
175Moms Xxx Movies/
176Xxx Tube Videos
177Dirty Mom Porn
178Forbidden Moms Porn
179Korean Xxx Movies
180Free Mature Pornstar
181Free Fuck Porn
182Asian Porn Videos
183Funny Moms Tube
184Xxx Online Porn
185Tube Porno Videos
186Gangbang Movies Porn
187Dildo Porn Clips
188Maid Tube Sex
189Slutty Daddy
190Oldman Porn Videos
191Hot Lesbian Sluts
192Hot Housewife Porn
193Asian Mom Porn
194KoK Porn Tube
195Bbw Xxx Tube
196Busty Milf Fuck
197Mature Babe Porn
198Perky Wives
199Xxx Wife Cheats
200Hardcore Tube Porn
We do not own, produce or host the Teen videos displayed on this website.
All of the Teen videos displayed here are hosted by websites that are not under our control
Abuse - Free Porn

Updated Time

Updating   
Friend links: ProxyFire    More...
Site Map 1 2 3 4 5 6 7 8 9 10 20 30 40 50 60 70 80 90 100 110 120 130 140 150 160 170 180 190 200 250 300 350 400 450 500 550 600 610 620 630 640 650 660 670 680 690 700 710 720 730 740 750
TOS | Contact us
© 2009 MyIP.cn Dev by MYIP Elapsed:2.037ms