INSERT INTO sites(host) VALUES('arionmovies.com') 1045: Access denied for user 'www-data'@'localhost' (using password: NO) arionmovies.com Estimated Worth $242,993 - MYIP.NET Website Information
Welcome to MyIP.net!
 Set MYIP as homepage      

  
           

Web Page Information

Title:
Meta Description:
Meta Keywords:
sponsored links:
Links:
Images:
Age:
sponsored links:

Traffic and Estimation

Traffic:
Estimation:

Website Ranks

Alexa Rank:
Google Page Rank:
Sogou Rank:
Baidu Cache:

Search Engine Indexed

Search EngineIndexedLinks
 Google:
 Bing:
 Yahoo!:
 Baidu:
 Sogou:
 Youdao:
 Soso:

Server Data

Web Server:
IP address:    
Location:

Registry information

Registrant:
Email:
ICANN Registrar:
Created:
Updated:
Expires:
Status:
Name Server:
Whois Server:

Alexa Rank and trends

Traffic: Today One Week Avg. Three Mon. Avg.
Rank:
PV:
Unique IP:

More ranks in the world

Users from these countries/regions

Where people go on this site

Alexa Charts

Alexa Reach and Rank

Whois data

Who is arionmovies.com at whois.enom.com





Domain Name:
ARIONMOVIES.COM

Registry Domain ID: 1256466428_DOMAIN_COM-VRSN

Registrar WHOIS Server: whois.enom.com

Registrar URL: www.enom.com

Updated Date: 2014-04-11T04:33:56.00Z

Creation Date: 2007-10-05T07:19:00.00Z

Registrar Registration Expiration Date: 2018-10-05T07:19:00.00Z

Registrar: ENOM, INC.

Registrar IANA ID: 48

Reseller: NAMECHEAP.COM

Domain Status: clientTransferProhibited https://www.icann.org/epp#clientTransferProhibited

Registry Registrant ID:

Registrant Name: JORDY PIETERS

Registrant Organization: N/A

Registrant Street: SERINGSTRAAT 18 APT. 9

Registrant City: EDERVEEN

Registrant State/Province: GELDERLAND

Registrant Postal Code: 6744 WZ

Registrant Country: NL

Registrant Phone: +31.1318571462

Registrant Phone Ext:

Registrant Fax:

Registrant Fax Ext:

Registrant Email: WEB

Registry Admin ID:

Admin Name: JORDY PIETERS

Admin Organization: N/A

Admin Street: SERINGSTRAAT 18 APT. 9

Admin City: EDERVEEN

Admin State/Province: GELDERLAND

Admin Postal Code: 6744 WZ

Admin Country: NL

Admin Phone: +31.1318571462

Admin Phone Ext:

Admin Fax:

Admin Fax Ext:

Admin Email: WEB

Registry Tech ID:

Tech Name: JORDY PIETERS

Tech Organization: N/A

Tech Street: SERINGSTRAAT 18 APT. 9

Tech City: EDERVEEN

Tech State/Province: GELDERLAND

Tech Postal Code: 6744 WZ

Tech Country: NL

Tech Phone: +31.1318571462

Tech Phone Ext:

Tech Fax:

Tech Fax Ext:

Tech Email: WEB

Name Server: ns1.fuckez.com

Name Server: ns2.fuckez.com

DNSSEC: unSigned

Registrar Abuse Contact Email: abuse@enom.com

Registrar Abuse Contact Phone: +1.4252982646

URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/

>>> Last update of WHOIS database: 2014-04-11T04:33:56.00Z <<<



For more information on Whois status codes, please visit https://icann.org/epp





The data in this whois database is provided to you for information

purposes only, that is, to assist you in obtaining information about or

related to a domain name registration record. We make this information

available "as is," and do not guarantee its accuracy. By submitting a

whois query, you agree that you will use this data only for lawful

purposes and that, under no circumstances will you use this data to: (1)

enable high volume, automated, electronic processes that stress or load

this whois database system providing you this information; or (2) allow,

enable, or otherwise support the transmission of mass unsolicited,

commercial advertising or solicitations via direct mail, electronic

mail, or by telephone. The compilation, repackaging, dissemination or

other use of this data is expressly prohibited without prior written

consent from us.



We reserve the right to modify these terms at any time. By submitting

this query, you agree to abide by these terms.

Version 6.3 4/3/2002

Front Page Thumbnail

sponsored links:

Front Page Loading Time

Keyword Hits (Biger,better)

Other TLDs of arionmovies

TLDs Created Expires Registered
.com
.net
.org
.cn
.com.cn
.asia
.mobi

Similar Websites

More...
Alexa鏍囬

Search Engine Spider Emulation

Title:Arion Movies . Com - Free Porn - Sex Tube
Description:Free porn and sex videos available absolutely free on Arion Movies. com! Enter the xxx world of unlimited homemade fuck videos, and you are sure to stay with us for hours!
Keywords:free porn, sex tube, xxx videos, anal sex, indian porn, asian movies
Body:
Arion Movies . Com - Free Porn - Sex Tube
Arion Porn Movies - great website full of never seen before xxx videos available absolutely free! We don't collect old hackneyed videos that you can easily find on any other free resources, but select only the most qualitative clips, which are sure to impress even the most discriminating sex fans. Enter the world of unlimited free porn, and you are sure to stay with us for hours!
Date
-any date-TodayYesterday2 days ago3 days ago4 days ago5 days ago6 days agoLast WeekWeek Ago
Length
-any len-0..5 minutes5..20 minutes20..40 minutes40..60 minutes60..90 minutes gt; 90 minutes
Tube
-any tube-HardsextubeHDpornOverThumbsPornerBrosPornHubRedTubeSunPornoTube8VID2CXhamsterXVideosXXXKinKyYobtYouPorn
Age
-all ages-18 year old19 year olddadgrannyinnocentmaturemilfmommothernunschoolgirlsisterteenuniversityvirginyoung
Country
-countries-africanamericanargentinianbrazilianbritishchinesecubanczechdutchegyptianfilipinafinnishfrenchgermangreekhawaiianindianindonesianitalianjapanesekoreanmexicanpakistanipolishrussianspanishswedishthaiturkish
Teen
694367 Teen Tube Videos
Forced
3551 Forced Tube Videos
Mature
358074 Mature Tube Videos
Perverted
24035 Perverted Tube Videos
Japanese
99914 Japanese Tube Videos
Vintage
34144 Vintage Tube Videos
Big Cock
253269 Big Cock Tube Videos
Wife
59189 Wife Tube Videos
18 Year Old
27094 18 Year Old Tube Videos
Story
4088 Story Tube Videos
Lesbian
206049 Lesbian Tube Videos
Classic
9947 Classic Tube Videos
Indian
13263 Indian Tube Videos
Old Young
31251 Old Young Tube Videos
Anal
348146 Anal Tube Videos
Home Made
95465 Home Made Tube Videos
Russian
66093 Russian Tube Videos
Shemale
60484 Shemale Tube Videos
Sleeping
2249 Sleeping Tube Videos
Amateur
716556 Amateur Tube Videos
Milf
182662 Milf Tube Videos
Swinger
10907 Swinger Tube Videos
Interracial
154904 Interracial Tube Videos
Arabian
7760 Arabian Tube Videos
German
25502 German Tube Videos
Italian
8507 Italian Tube Videos
Retro
3523 Retro Tube Videos
Public
185243 Public Tube Videos
Massage
59136 Massage Tube Videos
Czech
12443 Czech Tube Videos
Housewife
19661 Housewife Tube Videos
Old Man
9685 Old Man Tube Videos
French
15463 French Tube Videos
Seduce
18872 Seduce Tube Videos
Compilation
17513 Compilation Tube Videos
Bus
4320 Bus Tube Videos
Casting
30773 Casting Tube Videos
Hairy
122715 Hairy Tube Videos
Gangbang
39712 Gangbang Tube Videos
Bizarre
31004 Bizarre Tube Videos
Hidden Cam
34142 Hidden Cam Tube Videos
Orgasm
62887 Orgasm Tube Videos
Thai
6450 Thai Tube Videos
Maid
5365 Maid Tube Videos
Cum In Mouth
32853 Cum In Mouth Tube Videos
Ass
298011 Ass Tube Videos
Anime
11301 Anime Tube Videos
Doctor
8611 Doctor Tube Videos
Cheating
5544 Cheating Tube Videos
Gay
267466 Gay Tube Videos
Handjob
102677 Handjob Tube Videos
Cinema
413 Cinema Tube Videos
Beach
11143 Beach Tube Videos
Creampie
73415 Creampie Tube Videos
Party
82839 Party Tube Videos
Nudist
18720 Nudist Tube Videos
Asian
209179 Asian Tube Videos
Cuckold
36032 Cuckold Tube Videos
Bbw
154737 Bbw Tube Videos
Masturbating
353221 Masturbating Tube Videos
Bdsm
160950 Bdsm Tube Videos
Big Natural Tits
24944 Big Natural Tits Tube Videos
Slave
24661 Slave Tube Videos
Mature Amateur
93627 Mature Amateur Tube Videos
Ugly
1239 Ugly Tube Videos
Teacher
16259 Teacher Tube Videos
Fucking
769870 Fucking Tube Videos
Pornstar
135522 Pornstar Tube Videos
Prostitute
25046 Prostitute Tube Videos
Cash
9610 Cash Tube Videos
Spy
11349 Spy Tube Videos
Webcam
111270 Webcam Tube Videos
Husband
5651 Husband Tube Videos
Tranny
73891 Tranny Tube Videos
Game
12010 Game Tube Videos
Surprise
2554 Surprise Tube Videos
Blowjob
1097635 Blowjob Tube Videos
Voyeur
110640 Voyeur Tube Videos
African
12314 African Tube Videos
Animation
11181 Animation Tube Videos
Mmf
6381 Mmf Tube Videos
Nude
112180 Nude Tube Videos
Outdoor
83288 Outdoor Tube Videos
Mature Lesbian
42164 Mature Lesbian Tube Videos
British
20409 British Tube Videos
Insertion
12206 Insertion Tube Videos
Flasher
32714 Flasher Tube Videos
Chubby
25094 Chubby Tube Videos
Panties
35312 Panties Tube Videos
Rocco
1760 Rocco Tube Videos
Bisexual
44422 Bisexual Tube Videos
Small Cock
22520 Small Cock Tube Videos
Car
15237 Car Tube Videos
Prostate
1220 Prostate Tube Videos
Hermaphrodite
154 Hermaphrodite Tube Videos
Chinese
10238 Chinese Tube Videos
Cum
234248 Cum Tube Videos
Stockings
70594 Stockings Tube Videos
Fisting
22112 Fisting Tube Videos
Screaming
2604 Screaming Tube Videos
Group Sex
282555 Group Sex Tube Videos
Ebony
201937 Ebony Tube Videos
Black
173094 Black Tube Videos
3d
6547 3d Tube Videos
Filipina
1938 Filipina Tube Videos
Old Young Lesbian
3716 Old Young Lesbian Tube Videos
3some
147827 3some Tube Videos
Big Black Cock
45204 Big Black Cock Tube Videos
Cum Swallowing
31811 Cum Swallowing Tube Videos
Missionary
27293 Missionary Tube Videos
Secretary
5272 Secretary Tube Videos
Nun
717 Nun Tube Videos
Big Ass
117413 Big Ass Tube Videos
Orgy
60592 Orgy Tube Videos
Boss
6253 Boss Tube Videos
Sex
612690 Sex Tube Videos
Doggystyle
141360 Doggystyle Tube Videos
Busty
134439 Busty Tube Videos
Latina
99229 Latina Tube Videos
Strap On
76912 Strap On Tube Videos
Monster Cock
14026 Monster Cock Tube Videos
Tits
519778 Tits Tube Videos
Dildo
108122 Dildo Tube Videos
Lesbian Teen
52100 Lesbian Teen Tube Videos
Spanked
15432 Spanked Tube Videos
Deepthroat
45012 Deepthroat Tube Videos
Anal Creampie
25047 Anal Creampie Tube Videos
Gloryhole
15602 Gloryhole Tube Videos
Brazilian
14272 Brazilian Tube Videos
Glasses
12930 Glasses Tube Videos
Submissive
11322 Submissive Tube Videos
Kitchen
9716 Kitchen Tube Videos
DPed Anal
7277 DPed Anal Tube Videos
Swedish
2766 Swedish Tube Videos
Golden Shower
2521 Golden Shower Tube Videos
Pussy
411697 Pussy Tube Videos
Big Tits
403483 Big Tits Tube Videos
Student
58032 Student Tube Videos
Rimjob
11803 Rimjob Tube Videos
Whip
4950 Whip Tube Videos
Forest
2994 Forest Tube Videos
Flexible
2867 Flexible Tube Videos
Saggy Tits
1009 Saggy Tits Tube Videos
Couple
222133 Couple Tube Videos
Beauty
119762 Beauty Tube Videos
Femdom
40993 Femdom Tube Videos
Squirt
21183 Squirt Tube Videos
Emo
8429 Emo Tube Videos
Jerking
48244 Jerking Tube Videos
Office
16692 Office Tube Videos
Transsexual
16214 Transsexual Tube Videos
Crossdressing
9463 Crossdressing Tube Videos
Transvestite
7499 Transvestite Tube Videos
Milk
6114 Milk Tube Videos
Spanish
3692 Spanish Tube Videos
Mexican
3306 Mexican Tube Videos
Twins
1262 Twins Tube Videos
Fetish
670450 Fetish Tube Videos
Solo
125519 Solo Tube Videos
Sperm
54432 Sperm Tube Videos
Clit
48747 Clit Tube Videos
Bondage
41164 Bondage Tube Videos
Kinky
39108 Kinky Tube Videos
Gorgeous
37396 Gorgeous Tube Videos
Anus
20573 Anus Tube Videos
Nipples
19031 Nipples Tube Videos
Pantyhose
18564 Pantyhose Tube Videos
Upskirt
14555 Upskirt Tube Videos
Exhibitionists
2722 Exhibitionists Tube Videos
Clothed Sex
2098 Clothed Sex Tube Videos
Greek
533 Greek Tube Videos
Egyptian
519 Egyptian Tube Videos
Glamour
38971 Glamour Tube Videos
Doll
29828 Doll Tube Videos
Enema
637 Enema Tube Videos
Alien
278 Alien Tube Videos
Fat Mature
7942 Fat Mature Tube Videos
Hogtied
698 Hogtied Tube Videos
Turkish
3386 Turkish Tube Videos
Pakistani
542 Pakistani Tube Videos
Pages: 1 2 3 4 5 ... 12822
Today top searches
Search
. 12 inch
. 90s
. Amateur mature wife massage
. Amature wife
. Asian bbc
. Bulge
. Chubby shemale
. Daily basis
. Dominant mature
. Eating mature pussy
. Family blowjob
. German bbw
. German hairy
. German mature
. Grannies masturbating
. Hotel indian
. Indian pissing
. Interracial breeding
. Japanese hot mom
. Japanese lesbian schoolgirl teacher
. Japanese torture
. Lesbian asslick
. Lesbian mature seduce teen girl
. Lesbian muscle
. Masturbating mature orgasm
. Nipples bondage
. Public touch
. Riko tachibana
. Shemale barbie
. Shemale granny
. Super wet pussy
. Teen painful anal
. Teen solo orgasm
. Very young pussy
. Volleyball
. Wife cheating husband
. Wife friend
. Wife fuck stranger
. Wife group
. Wife teases
Free porn videos
Hot Pornstars Fucking
Search
A
B
C
D
E
F
G
H
I
J
K
L
M
N
O
P
Q
R
S
T
U
V
W
X
Y
Z
. Adriana Vega
. Adrianne
. Alice Bell
. Ashleigh Madisin
. Avena
. Camille Campos
. Candi Dreamz
. Christy Mack
. Elena Nichols
. Fonda French
. Haruna Katou
. Israel Oka
. Jamie Brooks
. Jasmin Black
. Jessica Right
. Jewell
. Lacey Marie
. Lana Cox
. Leili Koshi
. Mae Olsen
. Mai Nadasaka
. Maruschka Detmers
. Mija
. Navaya
. Oyeloca Feckled
. Renate
. Roxanne
. Silvia
. Sunny Day
. Suzy Spark
. Sweet Sinsacion
. Tanja Teen
. Teodor
. Tess
. Thena Sky
. Tia Sweet
. Titanic Toni
. Zoe Kush
Top List of Porn Tube Sites
1-40
01Porno Rama
02Video One
03Movie Mo
04Sex Tube Fuck
05Sfico
06DT Video
07Free Moms Sex
08Place of Porn
09Xxx Hd Videos
10XNXX Movies
11Nice Sex Tube
12Matures Naked
13Kinky Gonzo Porn
14Mag Post
15Best Xxx Fuck
16Filth Matures
17Sex Tube Club
18Hot Milf Clips
19Pink Dino
20Fat Fuck Tube
21Vintage Porn Videos
22Rulertube
23Crunk Movies
24Dildo Xxx Tube
25Hairy Tube
26KeX Tube
27Moms Fuck
28Sex Tube Videos
29Anal Sex Tube
30Mature Nude Porn
31Porn Tube Archive
32May Be Porn
33Hirsute Porn Legs
34QoQ Tube
35Stolen Wifes
36Stream Sex
37Mom Tube Sex
38Sex Tube Films
39World Porn Movies
40Live Granny
41-80
41Xhamster Porn
42New Sex TV
43La Xxx Porn
44Hardsextube Porn
45Hot Sex Tube
46Porno Videos
47Hq Sex Tubes
48Hard Porn
49Naked Boobs Porn
50Extreme Fetish Videos
51Sexy Sluts
52Boss Video
53Cum Comes
54Hd Porn
55Granny Porn Videos
56Beeg Tube
57Fuck Videos
58Plumper Xxx Videos
59Cute Porn TV
60Bush Pussy
61Homemade Videos
6221 Pornhub
63Naked Wife Porn
64Matures Fuck Tube
65Xxx Sex Anal
66Video You Tube
67Dwarfs Tube
68Free Porn Tube
69My Retro Tube
70Dino Tube
71Slutty Daddy
72XiX Porn Tube
73HuK Tube
74Hq Sex Video
75Redtube Porn
76Dads Sex Videos
77Free Milf Videos
78Xhamster
79My Xxx Movies
80Mature Videos Porn
81-120
81Free Mommy Porn
82Fat Fuck Xxx
83Gonzo Movies
84Goblins Tube
85Youporn.com
86Anal Xxx Tube
87Hot Fuck Films
88Porn Control
89Xvideos Porn
90Mommy Sex Movies
91Tapir Porn Tube
92Boobs Sex Videos
93Free Porn Tubes
94Sexy Hairy Women
95Hot Free Xxx
96Beeg Porn Tube
97Free Xxx Movies
98World Xxx Tube
99Incredible Asian Sex
100Porn Films Online
101Free Sex Porn
102Mature Babe Porn
103AzA Porn Tube
104Bbw Fuck Videos
105Hardsextube
106Korean Porn Tube
107Fuck Me Porn
108Car Tube Video
109Pipe Porn Tube
110Cash Video Tube
111Kaza Porn Tube
112Grow Sex Tube
113Pornesto
114Joker Sex Tube
115Ice Porn
116Fuck Porn Xxx
117Best Sex Tube
118Devils Gals
119Granny Xxx Films
120Live Porn Films
121-160
121Hard Homemade Porn
122Free Tube Porno
123Free Sex Videos
124Hidden Cam Porn
125Adult Xxx Films
126Free Xxx Tube
127Milf Fuck
128Classic Fuck Tube
129Home Private Vids
130Xxx Sex Fuck
131Wife Porno Movies
132Best Porn Tube
133Matures Nude Tube
134Mature Sex Tube
135KoK Porn Tube
136Anal Sex Tube
137Voyeur Sex Films
138All Milf Porn
139Asian Free Porns
140Moms Xxx Porn
141Hq Black Porn
142Asian Mom Porn
143Japanese Sex Videos
144Mommy Porn Videos
145Mature Free Porn
146Free Iphone Porn
147Public Porn Clips
148Free Hd Erotic
149Korean Sex Movies
150Hq Sex Movies
151Mature Fuck Videos
152Real Asian Porn
153Vibrator Porn Tube
154Mature Free Porn
155Mobile Porno Tube
156Free Iphone Sex
157Amateur Videos Porn
158Sexy Tuber Fuck
159Wife Xxx Porn
160Pussy Secret Sex
161-200
161Live Porn Videos
162Xxx Mature Videos
163Bbw Xxx Tube
164Mature Sex Clips
165Dildo Porn Clips
166Hot Fuck Webcam
167Fuck Cam Videos
168Porn Livesex Online
169Indian Sex Movies
170Gangbang Movies Porn
171Vip Porn Cams
172Free Hard Porn
173All Sex Tubes
174Free Sex Porno
175Tube Porno Videos
176Tranny Xxx Tube
177Free Mom Fuck
178Free Mature Sex
179Fresh Asian Porn
180Hairy Mobile Porno
181Moms Xxx Movies/
182Xxx Online Porn
183Xxx Tube Videos
184Dirty Mom Porn
185Forbidden Moms Porn
186Korean Xxx Movies
187Free Mature Pornstar
188Free Fuck Porn
189Asian Porn Videos
190Old Women Porn
191Xxx Porn Videos
192Hot Housewife Porn
193Mature Anal Sex
194Granny Sex Movs
195Free Movies Xxx
196Hidden Cams Sex
197Stream Sex Porn
198Matures Free Xxx
199Free Xxx Housewife
200Mature Free Fuck
We do not own, produce or host the Teen videos displayed on this website.
All of the Teen videos displayed here are hosted by websites that are not under our control
Abuse - Free Porn

Updated Time

Updating   
Friend links: ProxyFire    More...
Site Map 1 2 3 4 5 6 7 8 9 10 20 30 40 50 60 70 80 90 100 110 120 130 140 150 160 170 180 190 200 250 300 350 400 450 500 550 600 610 620 630 640 650 660 670 680 690 700 710 720 730 740 750
TOS | Contact us
© 2009 MyIP.cn Dev by MYIP Elapsed:42.340ms