INSERT INTO sites(host) VALUES('arionmovies.com') 1045: Access denied for user 'www-data'@'localhost' (using password: NO) arionmovies.com Estimated Worth $39,025 - MYIP.NET Website Information
Welcome to MyIP.net!
 Set MYIP as homepage      

  
           

Web Page Information

Title:
Meta Description:
Meta Keywords:
sponsored links:
Links:
Images:
Age:
sponsored links:

Traffic and Estimation

Traffic:
Estimation:

Website Ranks

Alexa Rank:
Google Page Rank:
Sogou Rank:
Baidu Cache:

Search Engine Indexed

Search EngineIndexedLinks
 Google:
 Bing:
 Yahoo!:
 Baidu:
 Sogou:
 Youdao:
 Soso:

Server Data

Web Server:
IP address:    
Location:

Registry information

Registrant:
Email:
ICANN Registrar:
Created:
Updated:
Expires:
Status:
Name Server:
Whois Server:

Alexa Rank and trends

Traffic: Today One Week Avg. Three Mon. Avg.
Rank:
PV:
Unique IP:

More ranks in the world

Users from these countries/regions

Where people go on this site

Alexa Charts

Alexa Reach and Rank

Whois data

Who is arionmovies.com at whois.enom.com





Domain Name:
ARIONMOVIES.COM

Registry Domain ID: 1256466428_DOMAIN_COM-VRSN

Registrar WHOIS Server: whois.enom.com

Registrar URL: www.enom.com

Updated Date: 2014-04-11T04:33:56.00Z

Creation Date: 2007-10-05T07:19:00.00Z

Registrar Registration Expiration Date: 2018-10-05T07:19:00.00Z

Registrar: ENOM, INC.

Registrar IANA ID: 48

Reseller: NAMECHEAP.COM

Domain Status: clientTransferProhibited https://www.icann.org/epp#clientTransferProhibited

Registry Registrant ID:

Registrant Name: JORDY PIETERS

Registrant Organization: N/A

Registrant Street: SERINGSTRAAT 18 APT. 9

Registrant City: EDERVEEN

Registrant State/Province: GELDERLAND

Registrant Postal Code: 6744 WZ

Registrant Country: NL

Registrant Phone: +31.1318571462

Registrant Phone Ext:

Registrant Fax:

Registrant Fax Ext:

Registrant Email: WEB

Registry Admin ID:

Admin Name: JORDY PIETERS

Admin Organization: N/A

Admin Street: SERINGSTRAAT 18 APT. 9

Admin City: EDERVEEN

Admin State/Province: GELDERLAND

Admin Postal Code: 6744 WZ

Admin Country: NL

Admin Phone: +31.1318571462

Admin Phone Ext:

Admin Fax:

Admin Fax Ext:

Admin Email: WEB

Registry Tech ID:

Tech Name: JORDY PIETERS

Tech Organization: N/A

Tech Street: SERINGSTRAAT 18 APT. 9

Tech City: EDERVEEN

Tech State/Province: GELDERLAND

Tech Postal Code: 6744 WZ

Tech Country: NL

Tech Phone: +31.1318571462

Tech Phone Ext:

Tech Fax:

Tech Fax Ext:

Tech Email: WEB

Name Server: ns1.fuckez.com

Name Server: ns2.fuckez.com

DNSSEC: unSigned

Registrar Abuse Contact Email: abuse@enom.com

Registrar Abuse Contact Phone: +1.4252982646

URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/

>>> Last update of WHOIS database: 2014-04-11T04:33:56.00Z <<<



For more information on Whois status codes, please visit https://icann.org/epp





The data in this whois database is provided to you for information

purposes only, that is, to assist you in obtaining information about or

related to a domain name registration record. We make this information

available "as is," and do not guarantee its accuracy. By submitting a

whois query, you agree that you will use this data only for lawful

purposes and that, under no circumstances will you use this data to: (1)

enable high volume, automated, electronic processes that stress or load

this whois database system providing you this information; or (2) allow,

enable, or otherwise support the transmission of mass unsolicited,

commercial advertising or solicitations via direct mail, electronic

mail, or by telephone. The compilation, repackaging, dissemination or

other use of this data is expressly prohibited without prior written

consent from us.



We reserve the right to modify these terms at any time. By submitting

this query, you agree to abide by these terms.

Version 6.3 4/3/2002

Front Page Thumbnail

sponsored links:

Front Page Loading Time

Keyword Hits (Biger,better)

Other TLDs of arionmovies

TLDs Created Expires Registered
.com
.net
.org
.cn
.com.cn
.asia
.mobi

Similar Websites

More...
Alexa鏍囬

Search Engine Spider Emulation

Title:Arion Movies . Com - Free Porn - Sex Tube
Description:Free porn and sex videos available absolutely free on Arion Movies. com! Enter the xxx world of unlimited homemade fuck videos, and you are sure to stay with us for hours!
Keywords:free porn, sex tube, xxx videos, anal sex, indian porn, asian movies
Body:
Arion Movies . Com - Free Porn - Sex Tube
Arion Porn Movies - great website full of never seen before xxx videos available absolutely free! We don't collect old hackneyed videos that you can easily find on any other free resources, but select only the most qualitative clips, which are sure to impress even the most discriminating sex fans. Enter the world of unlimited free porn, and you are sure to stay with us for hours!
Date
-any date-TodayYesterday2 days ago3 days agoLast WeekWeek Ago
Length
-any len-0..5 minutes5..20 minutes20..40 minutes40..60 minutes60..90 minutes gt; 90 minutes
Tube
-any tube-HardsextubeHDpornOverThumbsPornerBrosPornHubRedTubeSunPornoTube8VID2CXhamsterXVideosXXXKinKyYobtYouPorn
Age
-all ages-18 year old19 year olddadgrannyinnocentmaturemilfmommothernunschoolgirlsisterteenuniversityvirginyoung
Country
-countries-africanamericanargentinianbrazilianbritishchinesecubanczechdutchegyptianfilipinafinnishfrenchgermangreekhawaiianindianindonesianitalianjapanesekoreanmexicanpakistanipolishrussianspanishswedishthaiturkish
Teen
653424 Teen Tube Videos
Forced
2501 Forced Tube Videos
Mature
339090 Mature Tube Videos
18 Year Old
22198 18 Year Old Tube Videos
Home Made
77012 Home Made Tube Videos
Japanese
95198 Japanese Tube Videos
Classic
9592 Classic Tube Videos
Vintage
33785 Vintage Tube Videos
Anal
317645 Anal Tube Videos
Story
3238 Story Tube Videos
Wife
55472 Wife Tube Videos
Old Young
27515 Old Young Tube Videos
Lesbian
189659 Lesbian Tube Videos
Amateur
674894 Amateur Tube Videos
Compilation
17224 Compilation Tube Videos
Perverted
19630 Perverted Tube Videos
Indian
13174 Indian Tube Videos
Russian
63468 Russian Tube Videos
Big Cock
238444 Big Cock Tube Videos
Shemale
58829 Shemale Tube Videos
Milf
171763 Milf Tube Videos
Old Man
7998 Old Man Tube Videos
Public
168421 Public Tube Videos
Casting
21570 Casting Tube Videos
Mature Amateur
88844 Mature Amateur Tube Videos
German
25594 German Tube Videos
Sleeping
1824 Sleeping Tube Videos
Massage
53765 Massage Tube Videos
Arabian
7858 Arabian Tube Videos
Housewife
16883 Housewife Tube Videos
Bus
3924 Bus Tube Videos
Italian
8593 Italian Tube Videos
Cuckold
27129 Cuckold Tube Videos
Orgasm
53606 Orgasm Tube Videos
Seduce
16322 Seduce Tube Videos
Hidden Cam
34393 Hidden Cam Tube Videos
Creampie
66024 Creampie Tube Videos
Beach
10737 Beach Tube Videos
French
15403 French Tube Videos
Asian
201722 Asian Tube Videos
Hairy
103831 Hairy Tube Videos
Gay
256652 Gay Tube Videos
Interracial
137603 Interracial Tube Videos
Swinger
10661 Swinger Tube Videos
Anime
11118 Anime Tube Videos
Retro
3268 Retro Tube Videos
Voyeur
106889 Voyeur Tube Videos
Maid
5082 Maid Tube Videos
Surprise
2307 Surprise Tube Videos
Bdsm
142921 Bdsm Tube Videos
Handjob
88885 Handjob Tube Videos
Ass
267561 Ass Tube Videos
Cum In Mouth
20079 Cum In Mouth Tube Videos
Gangbang
34824 Gangbang Tube Videos
Teacher
14697 Teacher Tube Videos
Webcam
111935 Webcam Tube Videos
Bizarre
24918 Bizarre Tube Videos
Orgy
45814 Orgy Tube Videos
Cash
7728 Cash Tube Videos
Big Natural Tits
17874 Big Natural Tits Tube Videos
Czech
11446 Czech Tube Videos
Monster Cock
9941 Monster Cock Tube Videos
Old Young Lesbian
2451 Old Young Lesbian Tube Videos
Chubby
23553 Chubby Tube Videos
Slave
20959 Slave Tube Videos
Masturbating
337906 Masturbating Tube Videos
Student
48285 Student Tube Videos
Spy
10552 Spy Tube Videos
Cheating
5310 Cheating Tube Videos
Outdoor
75732 Outdoor Tube Videos
Party
69199 Party Tube Videos
Insertion
9438 Insertion Tube Videos
Thai
6245 Thai Tube Videos
Husband
5318 Husband Tube Videos
Cinema
375 Cinema Tube Videos
Ebony
184776 Ebony Tube Videos
Busty
118922 Busty Tube Videos
Tranny
72005 Tranny Tube Videos
Doctor
8191 Doctor Tube Videos
Ugly
1130 Ugly Tube Videos
Blowjob
997599 Blowjob Tube Videos
Bisexual
27166 Bisexual Tube Videos
Game
10254 Game Tube Videos
Prostitute
14243 Prostitute Tube Videos
Animation
11036 Animation Tube Videos
Screaming
2335 Screaming Tube Videos
Doggystyle
112663 Doggystyle Tube Videos
Flasher
28096 Flasher Tube Videos
British
18147 British Tube Videos
Chinese
8681 Chinese Tube Videos
3some
133400 3some Tube Videos
Rocco
1567 Rocco Tube Videos
Jerking
39831 Jerking Tube Videos
Exhibitionists
2020 Exhibitionists Tube Videos
Mature Lesbian
37071 Mature Lesbian Tube Videos
Car
13967 Car Tube Videos
Mexican
3412 Mexican Tube Videos
Tits
473072 Tits Tube Videos
Cum
203786 Cum Tube Videos
African
11584 African Tube Videos
Sex
522372 Sex Tube Videos
Anal Creampie
19604 Anal Creampie Tube Videos
Missionary
17382 Missionary Tube Videos
Twins
1104 Twins Tube Videos
Nude
82561 Nude Tube Videos
Nudist
18294 Nudist Tube Videos
Spanked
14352 Spanked Tube Videos
Double Fucking
8596 Double Fucking Tube Videos
Couple
203685 Couple Tube Videos
Fucking
670563 Fucking Tube Videos
Group Sex
247780 Group Sex Tube Videos
Pornstar
120052 Pornstar Tube Videos
Solo
115955 Solo Tube Videos
Beauty
103631 Beauty Tube Videos
Fisting
20591 Fisting Tube Videos
Cum Swallowing
19856 Cum Swallowing Tube Videos
Nun
668 Nun Tube Videos
Egyptian
555 Egyptian Tube Videos
Big Black Cock
41044 Big Black Cock Tube Videos
Submissive
9442 Submissive Tube Videos
Kitchen
8617 Kitchen Tube Videos
DPed Anal
6444 DPed Anal Tube Videos
Boss
5711 Boss Tube Videos
Bbw
139742 Bbw Tube Videos
Dildo
97344 Dildo Tube Videos
Lesbian Teen
47128 Lesbian Teen Tube Videos
Deepthroat
39501 Deepthroat Tube Videos
Panties
28946 Panties Tube Videos
Squirt
20310 Squirt Tube Videos
Transsexual
13953 Transsexual Tube Videos
Filipina
1888 Filipina Tube Videos
Big Tits
369476 Big Tits Tube Videos
Black
158376 Black Tube Videos
Stockings
63943 Stockings Tube Videos
Femdom
36104 Femdom Tube Videos
Bondage
35893 Bondage Tube Videos
Small Cock
19164 Small Cock Tube Videos
Nipples
16475 Nipples Tube Videos
Office
14982 Office Tube Videos
Upskirt
14423 Upskirt Tube Videos
Fat Mature
7175 Fat Mature Tube Videos
3d
6432 3d Tube Videos
Latina
94394 Latina Tube Videos
Strap On
57522 Strap On Tube Videos
Brazilian
14022 Brazilian Tube Videos
Secretary
4808 Secretary Tube Videos
Spanish
3586 Spanish Tube Videos
Golden Shower
2445 Golden Shower Tube Videos
Pakistani
479 Pakistani Tube Videos
Gorgeous
29954 Gorgeous Tube Videos
Doll
22695 Doll Tube Videos
Anus
14624 Anus Tube Videos
Gloryhole
13037 Gloryhole Tube Videos
Ffm
10263 Ffm Tube Videos
Transvestite
5648 Transvestite Tube Videos
Mmf
4947 Mmf Tube Videos
Turkish
3614 Turkish Tube Videos
Prostate
1107 Prostate Tube Videos
Enema
607 Enema Tube Videos
Hermaphrodite
134 Hermaphrodite Tube Videos
Anal Fisting
12504 Anal Fisting Tube Videos
Rimjob
10615 Rimjob Tube Videos
Milk
5756 Milk Tube Videos
Whip
4553 Whip Tube Videos
Alien
231 Alien Tube Videos
Pussy
351108 Pussy Tube Videos
Kinky
32994 Kinky Tube Videos
Pantyhose
17321 Pantyhose Tube Videos
Crossdressing
7904 Crossdressing Tube Videos
Swedish
2708 Swedish Tube Videos
Forest
2670 Forest Tube Videos
Behind The Scenes
1624 Behind The Scenes Tube Videos
Saggy Tits
1086 Saggy Tits Tube Videos
Greek
569 Greek Tube Videos
Big Ass
108780 Big Ass Tube Videos
Sperm
37567 Sperm Tube Videos
Clit
34501 Clit Tube Videos
Spreading
13471 Spreading Tube Videos
Classroom
2786 Classroom Tube Videos
Lezdom
2351 Lezdom Tube Videos
Pages: 1 2 3 4 5 ... 12188
Today top searches
Search
. Big daddy
. Black babysitter
. Bobbi bliss
. Bride stripper
. Compilation cum pussy
. Creampie swingers
. Cuckold mmf
. Ebony tube
. Encoxada
. Femaly
. Ff stockings
. Forced sex young girls rape
. Forced vintage
. Gaia
. Gorgeous granny
. Grandma grandson
. Hairy sleeping
. Indian gangbang
. Indian servant
. Japanese lesbian old young
. Japanese lesbian schoolgirl teacher
. Japanese love story
. Japanese tranny
. Japanese uncensored lesbians
. Lesbian teen tribbing
. Malay jilbab
. Milk tits asian
. Panteras ninha cabritinha
. Prostitute crackhead
. Retro gay
. Saree navel
. Tamil bbw
. Uncensor
. Uncensored asian milf
. Upskirt granny
. Vintage cum compilation
. Voyeur hairy
. Webcam skype
. Wendy taylor
. Young old creampie
Free porn videos
Hot Pornstars Fucking
Search
A
B
C
D
E
F
G
H
I
J
K
L
M
N
O
P
Q
R
S
T
U
V
W
X
Y
Z
. Alisa Kiss
. Anna Joy
. Axa Jay
. Bailey Jay
. Becca Bratt
. Cameo
. Demi More
. Dinara
. Fellucia Blow
. Fritz
. Gina Lee
. India Fox
. Janice Campbell
. Jaylnn West
. Jeff Dillon
. Karina Hart
. Magen
. Malia
. Miss Hot Butt
. Mylena Bysmark
. Nensi Medina
. Nikki Jayne
. Norah Swan
. Ryker
. Sandra Long
. Sasha Hall
. Sharon Lee
. Sonia Braga
. Tia
. Vanesa
. Victoria Givens
Top List of Porn Tube Sites
1-40
01Video One
02Porno Rama
0321 Pornhub
04Free Moms Sex
05Sex Tube Club
06Nice Sex Tube
07Sfico
08DT Video
09Kinky Gonzo Porn
10Sex Tube Films
11Sex Tube Fuck
12Place of Porn
13Movie Mo
14Cute Porn TV
15Voyeur Sex Films
16Best Sex Tube
17Dino Tube
18Video You Tube
19Free Anal Tube
20New Sex TV
21Mag Post
22Pink Dino
23Xhamster
24Xxx Sex Anal
25Hot Milf Clips
26Free Porn Tube
27Sexy Sluts
28Dildo Xxx Tube
29Ice Porn
30Kaza Porn Tube
31Paris Tube Porn
32Matures Naked
33Mom Tube Sex
34Anal Sex Tube
35Car Tube Video
36U Xxx Tube
37Xhamster Porn
38Cum Comes
39Hairy Tube
40Rulertube
41-80
41Live Granny
42Stream Sex
43Cash Video Tube
44Mr Porn
45Best Xxx Fuck
46Naked Wife Porn
47QoQ Tube
48Free Xxx Movies
49Redtube Porn
50Anal Xxx Tube
51Vintage Porn Videos
52Xxx Tube Movies
53Sexy Porn Clips
54Granny Sex Movs
55Hq Sex Tubes
56Pornesto
57Matures Fuck Tube
58XiX Porn Tube
59Dwarfs Tube
60Porn Tube Boobs
61Free Sex Tube
62Anal Sex Tube
63Mrs Sex Tube
64Dads Sex Videos
65Porn Tube Archive
66Pornhub
67XNXX Movies
68Youporn.com
69Oral Sex Movies
70Mature Videos Porn
71Moms Fuck
72Beeg Tube
73Granny Porn Videos
74Filth Matures
75Sweet Girls Tube
76Beeg Porn Tube
77Boss Video
78Mommy Sex Movies
79Hot Sex Tube
80Free Porno
81-120
81Naked Boobs Porn
82Mobile Porno Tube
83Free Iphone Porn
84Tapir Porn Tube
85Free Milf Videos
86Xxx Hd Videos
87Xxx Online Porn
88Movs Porn Tube
89Top Fuck Tube
90Try Free Porn
91Plumper Xxx Videos
92Suck Porn Tube
93Goblins Tube
94Hd Porn
95Dirty Mom Porn
96KeX Tube
97Xxx Tube Videos
98Lucky Porno Tube
99Free Fuck Mom
100Hardsextube Porn
101Gonzo Movies
102Free Sex Porno
103Grow Sex Tube
104Hardsextube
105Extreme Fetish Videos
106Spy Videos Tubes
107Xxx Sex Fuck
108Stolen Wifes
109Slutty Daddy
110KoK Porn Tube
111Free Amateur Porn
112Free Xxx Housewife
113Wow Fuck Tube
114Fuck Videos
115My Xxx Movies
116Porno Videos
117Hard Porn
118Free Sex Videos
119Hard Homemade Porn
120Matures Nude Tube
121-160
121Wife Porno Movies
122Flamingo Tube
123Real Asian Porn
124Sex Tube Videos
125Fuck Tube Movies
126Jizz Tube Porn
127My Retro Tube
128Crunk Movies
129Free Porn Tubes
130Hard Porn
131Wife Porn Tube
132Pipe Porn Tube
133Warm Pussy Tube
134White Porn Tube
135Matures Free Xxx
136Stream Sex Porn
137Public Porn Clips
138Hidden Cams Sex
139Sexy Tuber Fuck
140Free Iphone Sex
141May Be Porn
142Mature Anal Sex
143Pussy Secret Sex
144Free Hd Erotic
145Xxx Porn Videos
146Old Women Porn
147Mature Free Porn
148All Milf Porn
149Live Porn Videos
150Hq Black Porn
151Moms Xxx Porn
152Korean Sex Movies
153Xxx Mature Videos
154Mature Free Porn
155Mature Fuck Videos
156Best Porn Tube
157Japanese Sex Videos
158Mature Sex Clips
159Hairy Mobile Porno
160Moms Xxx Movies/
161-200
161Korean Xxx Movies
162Free Mature Pornstar
163Free Fuck Porn
164Asian Porn Videos
165Fuck Porn Xxx
166Tube Porno Videos
167Gangbang Movies Porn
168Dildo Porn Clips
169Maid Tube Sex
170Indian Porn Tube
171Oldman Porn Videos
172Hot Lesbian Sluts
173Hot Housewife Porn
174Asian Mom Porn
175Mommy Porn Videos
176Joker Sex Tube
177Mature Free Fuck
178Korean Porn Tube
179Free Mature Porn
180Busty Milf Fuck
181Free Sex Porn
182Xxx Wife Cheats
183Hardcore Tube Porn
184Free Sex Movies
185Mom Sex Tubes
186Hot Free Xxx
187Extra Milf Porn
188Hot Lesbian Porn
189Fuck Cam Videos
190Porn Livesex Online
191Indian Sex Movies
192Free Hard Porn
193All Sex Tubes
194Free Mature Sex
195Perky Wives
196Mommy Porno Videos
197Free Sex Tube
198Perfect Sex Movies
199Xvideos Porn
200XaX Tube
We do not own, produce or host the Teen videos displayed on this website.
All of the Teen videos displayed here are hosted by websites that are not under our control
Abuse - Free Porn

Updated Time

Updating   
Friend links: ProxyFire    More...
Site Map 1 2 3 4 5 6 7 8 9 10 20 30 40 50 60 70 80 90 100 110 120 130 140 150 160 170 180 190 200 250 300 350 400 450 500 550 600 610 620 630 640 650 660 670 680 690 700 710 720 730 740 750
TOS | Contact us
© 2009 MyIP.cn Dev by MYIP Elapsed:59.470ms