INSERT INTO sites(host) VALUES('arionmovies.com') 1045: Access denied for user 'www-data'@'localhost' (using password: NO) arionmovies.com Estimated Worth $99,095 - MYIP.NET Website Information
Welcome to MyIP.net!
 Set MYIP as homepage      

  
           

Web Page Information

Title:
Meta Description:
Meta Keywords:
sponsored links:
Links:
Images:
Age:
sponsored links:

Traffic and Estimation

Traffic:
Estimation:

Website Ranks

Alexa Rank:
Google Page Rank:
Sogou Rank:
Baidu Cache:

Search Engine Indexed

Search EngineIndexedLinks
 Google:
 Bing:
 Yahoo!:
 Baidu:
 Sogou:
 Youdao:
 Soso:

Server Data

Web Server:
IP address:    
Location:

Registry information

Registrant:
Email:
ICANN Registrar:
Created:
Updated:
Expires:
Status:
Name Server:
Whois Server:

Alexa Rank and trends

Traffic: Today One Week Avg. Three Mon. Avg.
Rank:
PV:
Unique IP:

More ranks in the world

Users from these countries/regions

Where people go on this site

Alexa Charts

Alexa Reach and Rank

Whois data

Who is arionmovies.com at whois.enom.com





Domain Name:
ARIONMOVIES.COM

Registry Domain ID: 1256466428_DOMAIN_COM-VRSN

Registrar WHOIS Server: whois.enom.com

Registrar URL: www.enom.com

Updated Date: 2014-04-11T04:33:56.00Z

Creation Date: 2007-10-05T07:19:00.00Z

Registrar Registration Expiration Date: 2018-10-05T07:19:00.00Z

Registrar: ENOM, INC.

Registrar IANA ID: 48

Reseller: NAMECHEAP.COM

Domain Status: clientTransferProhibited https://www.icann.org/epp#clientTransferProhibited

Registry Registrant ID:

Registrant Name: JORDY PIETERS

Registrant Organization: N/A

Registrant Street: SERINGSTRAAT 18 APT. 9

Registrant City: EDERVEEN

Registrant State/Province: GELDERLAND

Registrant Postal Code: 6744 WZ

Registrant Country: NL

Registrant Phone: +31.1318571462

Registrant Phone Ext:

Registrant Fax:

Registrant Fax Ext:

Registrant Email: WEB

Registry Admin ID:

Admin Name: JORDY PIETERS

Admin Organization: N/A

Admin Street: SERINGSTRAAT 18 APT. 9

Admin City: EDERVEEN

Admin State/Province: GELDERLAND

Admin Postal Code: 6744 WZ

Admin Country: NL

Admin Phone: +31.1318571462

Admin Phone Ext:

Admin Fax:

Admin Fax Ext:

Admin Email: WEB

Registry Tech ID:

Tech Name: JORDY PIETERS

Tech Organization: N/A

Tech Street: SERINGSTRAAT 18 APT. 9

Tech City: EDERVEEN

Tech State/Province: GELDERLAND

Tech Postal Code: 6744 WZ

Tech Country: NL

Tech Phone: +31.1318571462

Tech Phone Ext:

Tech Fax:

Tech Fax Ext:

Tech Email: WEB

Name Server: ns1.fuckez.com

Name Server: ns2.fuckez.com

DNSSEC: unSigned

Registrar Abuse Contact Email: abuse@enom.com

Registrar Abuse Contact Phone: +1.4252982646

URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/

>>> Last update of WHOIS database: 2014-04-11T04:33:56.00Z <<<



For more information on Whois status codes, please visit https://icann.org/epp





The data in this whois database is provided to you for information

purposes only, that is, to assist you in obtaining information about or

related to a domain name registration record. We make this information

available "as is," and do not guarantee its accuracy. By submitting a

whois query, you agree that you will use this data only for lawful

purposes and that, under no circumstances will you use this data to: (1)

enable high volume, automated, electronic processes that stress or load

this whois database system providing you this information; or (2) allow,

enable, or otherwise support the transmission of mass unsolicited,

commercial advertising or solicitations via direct mail, electronic

mail, or by telephone. The compilation, repackaging, dissemination or

other use of this data is expressly prohibited without prior written

consent from us.



We reserve the right to modify these terms at any time. By submitting

this query, you agree to abide by these terms.

Version 6.3 4/3/2002

Front Page Thumbnail

sponsored links:

Front Page Loading Time

Keyword Hits (Biger,better)

Other TLDs of arionmovies

TLDs Created Expires Registered
.com
.net
.org
.cn
.com.cn
.asia
.mobi

Similar Websites

More...
Alexa鏍囬

Search Engine Spider Emulation

Title:Arion Movies . Com - Free Porn - Sex Tube
Description:Free porn and sex videos available absolutely free on Arion Movies. com! Enter the xxx world of unlimited homemade fuck videos, and you are sure to stay with us for hours!
Keywords:free porn, sex tube, xxx videos, anal sex, indian porn, asian movies
Body:
Arion Movies . Com - Free Porn - Sex Tube
Arion Porn Movies - great website full of never seen before xxx videos available absolutely free! We don't collect old hackneyed videos that you can easily find on any other free resources, but select only the most qualitative clips, which are sure to impress even the most discriminating sex fans. Enter the world of unlimited free porn, and you are sure to stay with us for hours!
Date
-any date-TodayYesterday2 days ago3 days ago4 days ago5 days ago6 days agoLast WeekWeek Ago
Length
-any len-0..5 minutes5..20 minutes20..40 minutes40..60 minutes60..90 minutes gt; 90 minutes
Tube
-any tube-HardsextubeHDpornOverThumbsPornerBrosPornHubRedTubeSunPornoTube8VID2CXhamsterXVideosXXXKinKyYobtYouPorn
Age
-all ages-18 year old19 year olddadgrannyinnocentmaturemilfmommothernunschoolgirlsisterteenuniversityvirginyoung
Country
-countries-africanamericanargentinianbrazilianbritishchinesecubanczechdutchegyptianfilipinafinnishfrenchgermangreekhawaiianindianindonesianitalianjapanesekoreanmexicanpakistanipolishrussianspanishswedishthaiturkish
Teen
652538 Teen Tube Videos
Forced
2501 Forced Tube Videos
Mature
337931 Mature Tube Videos
18 Year Old
22195 18 Year Old Tube Videos
Home Made
76752 Home Made Tube Videos
Japanese
95068 Japanese Tube Videos
Classic
9577 Classic Tube Videos
Vintage
33703 Vintage Tube Videos
Wife
55150 Wife Tube Videos
Anal
317182 Anal Tube Videos
Compilation
17177 Compilation Tube Videos
Perverted
19606 Perverted Tube Videos
Story
3231 Story Tube Videos
Amateur
672997 Amateur Tube Videos
Lesbian
189455 Lesbian Tube Videos
Old Young
27351 Old Young Tube Videos
Indian
13099 Indian Tube Videos
Milf
171137 Milf Tube Videos
Russian
63403 Russian Tube Videos
Mature Amateur
88507 Mature Amateur Tube Videos
Arabian
7806 Arabian Tube Videos
Public
168088 Public Tube Videos
Shemale
58583 Shemale Tube Videos
Big Cock
237922 Big Cock Tube Videos
Old Man
7986 Old Man Tube Videos
Casting
21538 Casting Tube Videos
Sleeping
1823 Sleeping Tube Videos
German
25401 German Tube Videos
Surprise
2302 Surprise Tube Videos
Bus
3922 Bus Tube Videos
Hidden Cam
34176 Hidden Cam Tube Videos
French
15301 French Tube Videos
Hairy
103708 Hairy Tube Videos
Beach
10704 Beach Tube Videos
Massage
53729 Massage Tube Videos
Cuckold
27037 Cuckold Tube Videos
Retro
3262 Retro Tube Videos
Orgasm
53449 Orgasm Tube Videos
Housewife
16856 Housewife Tube Videos
Asian
201425 Asian Tube Videos
Swinger
10634 Swinger Tube Videos
Bdsm
142597 Bdsm Tube Videos
Cum In Mouth
19971 Cum In Mouth Tube Videos
Gay
255168 Gay Tube Videos
Anime
11116 Anime Tube Videos
Creampie
65908 Creampie Tube Videos
Masturbating
337184 Masturbating Tube Videos
Seduce
16311 Seduce Tube Videos
Voyeur
106255 Voyeur Tube Videos
Gangbang
34746 Gangbang Tube Videos
Ass
267238 Ass Tube Videos
Slave
20926 Slave Tube Videos
Maid
5062 Maid Tube Videos
Czech
11437 Czech Tube Videos
Orgy
45780 Orgy Tube Videos
Teacher
14664 Teacher Tube Videos
Interracial
137312 Interracial Tube Videos
Chubby
23525 Chubby Tube Videos
Italian
8546 Italian Tube Videos
Handjob
88691 Handjob Tube Videos
Monster Cock
9937 Monster Cock Tube Videos
Cash
7722 Cash Tube Videos
Webcam
111450 Webcam Tube Videos
Student
48274 Student Tube Videos
Insertion
9431 Insertion Tube Videos
Husband
5304 Husband Tube Videos
Outdoor
75580 Outdoor Tube Videos
Party
69170 Party Tube Videos
Bizarre
24915 Bizarre Tube Videos
Ugly
1126 Ugly Tube Videos
Cheating
5276 Cheating Tube Videos
Big Natural Tits
17529 Big Natural Tits Tube Videos
Doctor
8181 Doctor Tube Videos
Old Young Lesbian
2449 Old Young Lesbian Tube Videos
Cinema
374 Cinema Tube Videos
3some
133269 3some Tube Videos
Tranny
71746 Tranny Tube Videos
Twins
1104 Twins Tube Videos
Ebony
184441 Ebony Tube Videos
Flasher
27990 Flasher Tube Videos
Prostitute
14236 Prostitute Tube Videos
Rocco
1562 Rocco Tube Videos
Blowjob
996067 Blowjob Tube Videos
Spy
10511 Spy Tube Videos
Busty
118840 Busty Tube Videos
Doggystyle
112461 Doggystyle Tube Videos
Spanked
14287 Spanked Tube Videos
Animation
11036 Animation Tube Videos
Game
10244 Game Tube Videos
Tits
472041 Tits Tube Videos
African
11563 African Tube Videos
Boss
5702 Boss Tube Videos
Exhibitionists
2011 Exhibitionists Tube Videos
British
18045 British Tube Videos
Screaming
2334 Screaming Tube Videos
Bbw
139239 Bbw Tube Videos
Bisexual
27145 Bisexual Tube Videos
Thai
6221 Thai Tube Videos
Nun
668 Nun Tube Videos
Dildo
97167 Dildo Tube Videos
Panties
28891 Panties Tube Videos
Cum Swallowing
19793 Cum Swallowing Tube Videos
Nudist
18195 Nudist Tube Videos
Chinese
8665 Chinese Tube Videos
Big Tits
368632 Big Tits Tube Videos
Lesbian Teen
47086 Lesbian Teen Tube Videos
Big Black Cock
40973 Big Black Cock Tube Videos
Mexican
3359 Mexican Tube Videos
Filipina
1877 Filipina Tube Videos
Couple
203638 Couple Tube Videos
Mature Lesbian
37024 Mature Lesbian Tube Videos
Gorgeous
29930 Gorgeous Tube Videos
Anal Creampie
19590 Anal Creampie Tube Videos
Nipples
16402 Nipples Tube Videos
Fucking
669935 Fucking Tube Videos
Cum
203290 Cum Tube Videos
Missionary
17378 Missionary Tube Videos
Upskirt
14336 Upskirt Tube Videos
Spanish
3561 Spanish Tube Videos
Egyptian
544 Egyptian Tube Videos
Sex
521870 Sex Tube Videos
Pussy
350769 Pussy Tube Videos
Solo
115887 Solo Tube Videos
Stockings
63815 Stockings Tube Videos
Jerking
39788 Jerking Tube Videos
Small Cock
19107 Small Cock Tube Videos
Brazilian
13975 Brazilian Tube Videos
Car
13949 Car Tube Videos
DPed Anal
6433 DPed Anal Tube Videos
Beauty
103562 Beauty Tube Videos
Squirt
20216 Squirt Tube Videos
Anus
14621 Anus Tube Videos
Ffm
10263 Ffm Tube Videos
Crossdressing
7883 Crossdressing Tube Videos
Pornstar
119936 Pornstar Tube Videos
Nude
82506 Nude Tube Videos
Femdom
36035 Femdom Tube Videos
Office
14977 Office Tube Videos
Transsexual
13904 Transsexual Tube Videos
Kitchen
8612 Kitchen Tube Videos
Double Fucking
8590 Double Fucking Tube Videos
Mmf
4943 Mmf Tube Videos
Golden Shower
2445 Golden Shower Tube Videos
Strap On
57471 Strap On Tube Videos
Deepthroat
39486 Deepthroat Tube Videos
Fisting
20543 Fisting Tube Videos
Pantyhose
17276 Pantyhose Tube Videos
Anal Fisting
12496 Anal Fisting Tube Videos
Milk
5736 Milk Tube Videos
Turkish
3581 Turkish Tube Videos
Saggy Tits
1064 Saggy Tits Tube Videos
Hermaphrodite
134 Hermaphrodite Tube Videos
Group Sex
247503 Group Sex Tube Videos
Black
158057 Black Tube Videos
Latina
94081 Latina Tube Videos
Kinky
32985 Kinky Tube Videos
Gloryhole
13019 Gloryhole Tube Videos
Rimjob
10604 Rimjob Tube Videos
Submissive
9428 Submissive Tube Videos
Fat Mature
7165 Fat Mature Tube Videos
Whip
4542 Whip Tube Videos
Swedish
2695 Swedish Tube Videos
Prostate
1107 Prostate Tube Videos
Enema
599 Enema Tube Videos
Alien
227 Alien Tube Videos
Bondage
35856 Bondage Tube Videos
Clit
34470 Clit Tube Videos
Doll
22670 Doll Tube Videos
Transvestite
5643 Transvestite Tube Videos
Secretary
4791 Secretary Tube Videos
Greek
558 Greek Tube Videos
Big Ass
108619 Big Ass Tube Videos
Riding
54725 Riding Tube Videos
Sperm
37533 Sperm Tube Videos
Glamour
31224 Glamour Tube Videos
Spreading
13466 Spreading Tube Videos
3d
6427 3d Tube Videos
Pakistani
470 Pakistani Tube Videos
Wrestling
3073 Wrestling Tube Videos
Forest
2665 Forest Tube Videos
Pages: 1 2 3 4 5 ... 12161
Today top searches
Search
. Amai liu
. Amateur mature wife cheating
. Amateur mature wife massage
. Amateur sister brother
. Amateur wife ass
. Amateur wife sharing
. Amatuer ffm
. Ancient
. Arabian hidden cam
. Asian mom son
. Australian pussy
. Bbw arab
. Black stepsister
. Brutal deepthroat
. Ebony ladyboy
. French teens casting
. Friend fucks my wife
. Fuck me mom
. German swingerclub
. Ghana sex
. Hairy sleeping
. Indian doctor
. Interracial slave
. Japanese hidden cam
. Japanese massage hidden camera
. Japanese schoolgirl
. Lesbian schoolgirl teacher
. Masturbation hidden cam
. Mature amateur cuckold
. Mature french
. Milk pregnant
. Rubber latex
. Russian gay boys
. Shemale smoking
. Skinny orgasm
. South indian
. Student initiation
. Tranny old
. Ukrainian teen
. Webcam skype
Free porn videos
Hot Pornstars Fucking
Search
A
B
C
D
E
F
G
H
I
J
K
L
M
N
O
P
Q
R
S
T
U
V
W
X
Y
Z
. Adriana Lynn
. Alana Jade
. Ally Style
. Amanda Tapping
. Amberly
. Ayumi Kobayashi
. Bruno Dickenz
. Cammie Fox
. Cassie
. Dee Lynn
. Elena Cole
. Elena Rivera
. Elle Alexandra
. Evelyn Ling
. Juana
. Kara Davis
. Kenna
. Laurah
. Lenka
. Lidia
. Michaela Borovska
. Natalie Nice
. Nikki Bell
. Olive
. Puffy
. Susie Sorrento
. Traci Bingham
. Vicky Vee
. Webb
. Yasmine Loven
Top List of Porn Tube Sites
1-40
01Video One
02Movie Mo
03Porno Rama
04My Retro Tube
05Hot Milf Clips
06Free Moms Sex
07DT Video
08Sfico
09Porn Tube Boobs
10Porn Tube Archive
11Pink Dino
12Sex Tube Club
13Free Porn Tube
14Nice Sex Tube
15Hot Sex Tube
16Sex Tube Films
1721 Pornhub
18XNXX Movies
19Pipe Porn Tube
20Video You Tube
21Mag Post
22Xxx Sex Anal
23May Be Porn
24Anal Sex Tube
25New Sex TV
26Kinky Gonzo Porn
27Matures Naked
28Hardsextube Porn
29Car Tube Video
30Rulertube
31Dwarfs Tube
32Goblins Tube
33Dildo Xxx Tube
34Hairy Tube
35Hot Fuck Films
36Live Granny
37Sexy Sluts
38Pornesto
39Xhamster Porn
40Wife Porno Movies
41-80
41Xvideos Sex
42Youporn.com
43Free Sex Tube
44Oral Sex Movies
45Paris Tube Porn
46Stream Sex
47Xxx Online Porn
48World Porn Movies
49Beeg Porn Tube
50QoQ Tube
51KeX Tube
52Perfect Sex Movies
53Home Private Vids
54Vintage Porn Videos
55Sex Tube Fuck
56La Xxx Porn
57Hard Porn
58Mom Tube Sex
59Joker Sex Tube
60Korean Xxx Movies
61Boss Video
62Older Mom Tube
63Xxx Tube Movies
64U Xxx Tube
65Hq Sex Tubes
66Best Xxx Fuck
67Spy Videos Tubes
68Hardsextube
69Naked Wife Porn
70White Porn Tube
71Xxx Wife Cheats
72Matures Fuck Tube
73Extreme Fetish Videos
74Free Porn Tubes
75Suck Porn Tube
76Redtube Porn
77Fat Fuck Tube
78Free Porno
79Naked Boobs Porn
80XiX Porn Tube
81-120
81Crunk Movies
82KoK Porn Tube
83Mommy Sex Movies
84Best Sex Tube
85Diamond Tubes
86Cum Comes
87Cash Video Tube
88Honey Porn Tube
89Fucking Tube Xxx
90Homemade Videos
91Flamingo Tube
92AzA Porn Tube
93Dads Sex Videos
94Classic Fuck Tube
95Granny Porn Videos
96Tapir Porn Tube
97Free Fuck Mom
98Moms Fuck
99Fuck Anal Tube
100Free Milf Videos
101Plumper Xxx Videos
102Fuck Videos
103Asian Mom Porn
104Dirty Mom Porn
105Stolen Wifes
106Free Sex Porn
107Free Xxx Housewife
108Granny Sex Movs
109Real Asian Porn
110Free Hd Erotic
111Slutty Daddy
112Hard Homemade Porn
113Best Mobile Sex
114Hidden Cam Porn
115Free Mommy Porn
116Boobs Xxx Porn
117Kaza Porn Tube
118Hairy Porno Videos
119Filth Matures
120Sexy Hairy Women
121-160
121My Xxx Movies
122Devils Gals
123Wife Porn Tube
124Place of Porn
125Anal Sex Tube
126Cute Porn TV
127Pornhub
128Mr Porn
129Anal Xxx Tube
130Hd Porn
131Free Sex Tube
132Boobs Sex Videos
133Matures Nude Tube
134Mature Nude Porn
135Wow Fuck Tube
136Dino Tube
137Movs Porn Tube
138Sex Tube Videos
139Mature Videos Porn
140World Xxx Tube
141Gonzo Movies
142Chubby Porn Xxx
143Busty Milf Fuck
144Free Mature Porn
145Korean Porn Tube
146Mature Free Fuck
147Moms Xxx Porn
148Mature Free Porn
149Hq Black Porn
150Mobile Porno Tube
151All Milf Porn
152Free Iphone Sex
153Sexy Tuber Fuck
154Porno Videos
155Pussy Secret Sex
156Matures Free Xxx
157Stream Sex Porn
158Hidden Cams Sex
159Live Porn Videos
160Brown Xxx Tube
161-200
161Mature Anal Sex
162Xxx Mature Videos
163Best Porn Tube
164Xxx Porn Videos
165Mature Sex Clips
166Old Women Porn
167Free Iphone Porn
168Japanese Sex Videos
169Mature Free Porn
170Hard Porn
171Free Mature Pornstar
172Free Fuck Porn
173Asian Porn Videos
174Fuck Porn Xxx
175Fuck Tube Movies
176Tube Porno Videos
177Gangbang Movies Porn
178Dildo Porn Clips
179Maid Tube Sex
180Indian Porn Tube
181Oldman Porn Videos
182Hot Lesbian Sluts
183Hot Housewife Porn
184Free Sex Videos
185Mommy Porn Videos
186All Fuck Tube
187Free Xxx Tube
188Hardcore Tube Porn
189Free Sex Movies
190Mom Sex Tubes
191Hot Free Xxx
192Extra Milf Porn
193Hot Lesbian Porn
194Fuck Cam Videos
195Porn Livesex Online
196Indian Sex Movies
197Free Hard Porn
198All Sex Tubes
199Free Sex Porno
200Free Mature Sex
We do not own, produce or host the Teen videos displayed on this website.
All of the Teen videos displayed here are hosted by websites that are not under our control
Abuse - Free Porn

Updated Time

Updating   
Friend links: ProxyFire    More...
Site Map 1 2 3 4 5 6 7 8 9 10 20 30 40 50 60 70 80 90 100 110 120 130 140 150 160 170 180 190 200 250 300 350 400 450 500 550 600 610 620 630 640 650 660 670 680 690 700 710 720 730 740 750
TOS | Contact us
© 2009 MyIP.cn Dev by MYIP Elapsed:1.461ms