INSERT INTO sites(host) VALUES('arionmovies.com') 1045: Access denied for user 'www-data'@'localhost' (using password: NO) arionmovies.com Estimated Worth $367,215 - MYIP.NET Website Information
Welcome to MyIP.net!
 Set MYIP as homepage      

  
           

Web Page Information

Title:
Meta Description:
Meta Keywords:
sponsored links:
Links:
Images:
Age:
sponsored links:

Traffic and Estimation

Traffic:
Estimation:

Website Ranks

Alexa Rank:
Google Page Rank:
Sogou Rank:
Baidu Cache:

Search Engine Indexed

Search EngineIndexedLinks
 Google:
 Bing:
 Yahoo!:
 Baidu:
 Sogou:
 Youdao:
 Soso:

Server Data

Web Server:
IP address:    
Location:

Registry information

Registrant:
Email:
ICANN Registrar:
Created:
Updated:
Expires:
Status:
Name Server:
Whois Server:

Alexa Rank and trends

Traffic: Today One Week Avg. Three Mon. Avg.
Rank:
PV:
Unique IP:

More ranks in the world

Users from these countries/regions

Where people go on this site

Alexa Charts

Alexa Reach and Rank

Whois data

Who is arionmovies.com at com.whois-servers.net

Domain Name: ARIONMOVIES.COM

Registry Domain ID: 1256466428_DOMAIN_COM-VRSN

Registrar WHOIS Server: whois.enom.com

Registrar URL:
http://www.enom.com

Updated Date: 2017-03-06T16:16:50Z

Creation Date: 2007-10-05T07:19:25Z

Registry Expiry Date: 2018-10-05T07:19:25Z

Registrar: eNom, Inc.

Registrar IANA ID: 48

Registrar Abuse Contact Email:

Registrar Abuse Contact Phone:

Domain Status: clientTransferProhibited
https://icann.org/epp#clientTransferProhibited

Name Server:
ns1.fuckez.com

Name Server:
ns2.fuckez.com

DNSSEC: unsigned

URL of the ICANN Whois Inaccuracy Complaint Form:
https://www.icann.org/wicf/

>>> Last update of whois database: 2017-07-27T10:52:23Z <<<



For more information on Whois status codes, please visit
https://icann.org/epp



NOTICE:
The expiration date displayed in this record is the date the

registrar's sponsorship of the domain name registration in the registry is

currently set to expire. This date does not necessarily reflect the expiration

date of the domain name registrant's agreement with the sponsoring

registrar. Users may consult the sponsoring registrar's Whois database to

view the registrar's reported date of expiration for this registration.



TERMS OF USE:
You are not authorized to access or query our Whois

database through the use of electronic processes that are high-volume and

automated except as reasonably necessary to register domain names or

modify existing registrations; the Data in VeriSign Global Registry

Services' ("VeriSign") Whois database is provided by VeriSign for

information purposes only, and to assist persons in obtaining information

about or related to a domain name registration record. VeriSign does not

guarantee its accuracy. By submitting a Whois query, you agree to abide

by the following terms of use: You agree that you may use this Data only

for lawful purposes and that under no circumstances will you use this Data

to:
(1) allow, enable, or otherwise support the transmission of mass

unsolicited, commercial advertising or solicitations via e-mail, telephone,

or facsimile; or (2) enable high volume, automated, electronic processes

that apply to VeriSign (or its computer systems). The compilation,

repackaging, dissemination or other use of this Data is expressly

prohibited without the prior written consent of VeriSign. You agree not to

use electronic processes that are automated and high-volume to access or

query the Whois database except as reasonably necessary to register

domain names or modify existing registrations. VeriSign reserves the right

to restrict your access to the Whois database in its sole discretion to ensure

operational stability. VeriSign may restrict or terminate your access to the

Whois database for failure to abide by these terms of use. VeriSign

reserves the right to modify these terms at any time.



The Registry database contains ONLY .COM, .NET, .EDU domains and

Registrars.

Front Page Thumbnail

sponsored links:

Front Page Loading Time

Keyword Hits (Biger,better)

Other TLDs of arionmovies

TLDs Created Expires Registered
.com
.net
.org
.cn
.com.cn
.asia
.mobi

Similar Websites

More...
Alexa鏍囬

Search Engine Spider Emulation

Title:Arion Movies . Com - Free Porn - Sex Tube
Description:Free porn and sex videos available absolutely free on Arion Movies. com! Enter the xxx world of unlimited homemade fuck videos, and you are sure to stay with us for hours!
Keywords:free porn, sex tube, xxx videos, anal sex, indian porn, asian movies
Body:
Arion Movies . Com - Free Porn - Sex Tube
Arion Porn Movies - great website full of never seen before xxx videos available absolutely free! We don't collect old hackneyed videos that you can easily find on any other free resources, but select only the most qualitative clips, which are sure to impress even the most discriminating sex fans. Enter the world of unlimited free porn, and you are sure to stay with us for hours!
Date
-any date-TodayYesterday3 days ago4 days ago5 days agoLast Week6 days agoWeek Ago
Length
-any len-0..5 minutes5..20 minutes20..40 minutes40..60 minutes60..90 minutes gt; 90 minutes
Tube
-any tube-HardsextubeHDpornOverThumbsPornerBrosPornHubRedTubeSunPornoTube8VID2CXhamsterXVideosXXXKinKyYobtYouPorn
Age
-all ages-18 year old19 year olddadgrannyinnocentmaturemilfmommothernunschoolgirlsisterteenuniversityvirginyoung
Country
-countries-africanamericanargentinianbrazilianbritishchinesecubanczechdutchegyptianfilipinafinnishfrenchgermangreekhawaiianindianindonesianitalianjapanesekoreanmexicanpakistanipolishrussianspanishswedishthaiturkish
Teen
652697 Teen Tube Videos
Forced
2501 Forced Tube Videos
Mature
337522 Mature Tube Videos
Japanese
94873 Japanese Tube Videos
Home Made
77070 Home Made Tube Videos
Vintage
33271 Vintage Tube Videos
Classic
9529 Classic Tube Videos
18 Year Old
22187 18 Year Old Tube Videos
Old Young
27489 Old Young Tube Videos
First Time
26903 First Time Tube Videos
Wife
55126 Wife Tube Videos
Anal
316903 Anal Tube Videos
Lesbian
189361 Lesbian Tube Videos
Perverted
19652 Perverted Tube Videos
Story
3269 Story Tube Videos
Creampie
65726 Creampie Tube Videos
Indian
13104 Indian Tube Videos
Old Man
8004 Old Man Tube Videos
Amateur
672455 Amateur Tube Videos
Young
92099 Young Tube Videos
Russian
63400 Russian Tube Videos
Compilation
17161 Compilation Tube Videos
Shemale
58675 Shemale Tube Videos
Surprise
2305 Surprise Tube Videos
Milf
171153 Milf Tube Videos
German
25261 German Tube Videos
Massage
53713 Massage Tube Videos
Bus
3913 Bus Tube Videos
Babysitter
5017 Babysitter Tube Videos
Hidden Cam
34164 Hidden Cam Tube Videos
Casting
21612 Casting Tube Videos
Housewife
16837 Housewife Tube Videos
Arabian
7773 Arabian Tube Videos
Public
168118 Public Tube Videos
Gangbang
34651 Gangbang Tube Videos
French
15189 French Tube Videos
Orgasm
53556 Orgasm Tube Videos
Swinger
10577 Swinger Tube Videos
Italian
8550 Italian Tube Videos
Cartoon
13008 Cartoon Tube Videos
Interracial
137159 Interracial Tube Videos
Hairy
103587 Hairy Tube Videos
Thai
6191 Thai Tube Videos
Big Cock
238813 Big Cock Tube Videos
Handjob
88685 Handjob Tube Videos
Sleeping
1825 Sleeping Tube Videos
Asian Teen
34389 Asian Teen Tube Videos
Voyeur
106304 Voyeur Tube Videos
Retro
3247 Retro Tube Videos
Mature Amateur
88209 Mature Amateur Tube Videos
Cuckold
27043 Cuckold Tube Videos
Hentai
18567 Hentai Tube Videos
Maid
5067 Maid Tube Videos
Seduce
16310 Seduce Tube Videos
Gay
255274 Gay Tube Videos
Beach
10695 Beach Tube Videos
Cheating
5316 Cheating Tube Videos
Monster Cock
9942 Monster Cock Tube Videos
Masturbating
337255 Masturbating Tube Videos
Slave
20966 Slave Tube Videos
Czech
11435 Czech Tube Videos
Petite
42961 Petite Tube Videos
Big Natural Tits
17727 Big Natural Tits Tube Videos
Cum In Mouth
20081 Cum In Mouth Tube Videos
Jerking
39777 Jerking Tube Videos
Webcam
111808 Webcam Tube Videos
Party
69197 Party Tube Videos
Ass
267351 Ass Tube Videos
Asian
201128 Asian Tube Videos
Bdsm
142701 Bdsm Tube Videos
Bizarre
24917 Bizarre Tube Videos
Cinema
371 Cinema Tube Videos
Skinny
40046 Skinny Tube Videos
Teacher
14719 Teacher Tube Videos
Exhibitionists
2015 Exhibitionists Tube Videos
Chubby
23527 Chubby Tube Videos
Game
10234 Game Tube Videos
Doctor
8184 Doctor Tube Videos
3some
133036 3some Tube Videos
African
11643 African Tube Videos
Spy
10556 Spy Tube Videos
Cash
7729 Cash Tube Videos
Husband
5300 Husband Tube Videos
Outdoor
75677 Outdoor Tube Videos
Ugly
1132 Ugly Tube Videos
Bbw
138977 Bbw Tube Videos
Blowjob
995457 Blowjob Tube Videos
Ebony
184557 Ebony Tube Videos
Tranny
71857 Tranny Tube Videos
Student
48279 Student Tube Videos
British
17974 British Tube Videos
Old Young Lesbian
2436 Old Young Lesbian Tube Videos
Nun
665 Nun Tube Videos
Flasher
27987 Flasher Tube Videos
Insertion
9425 Insertion Tube Videos
Sex
521684 Sex Tube Videos
Big Black Cock
41107 Big Black Cock Tube Videos
Rocco
1567 Rocco Tube Videos
Cum
203360 Cum Tube Videos
Nude
82542 Nude Tube Videos
Fisting
20568 Fisting Tube Videos
Spanked
14330 Spanked Tube Videos
DPed Anal
6417 DPed Anal Tube Videos
Nudist
18161 Nudist Tube Videos
Prostitute
14229 Prostitute Tube Videos
Egyptian
524 Egyptian Tube Videos
Anime
11117 Anime Tube Videos
Couple
203627 Couple Tube Videos
Lesbian Teen
47081 Lesbian Teen Tube Videos
Bisexual
27118 Bisexual Tube Videos
Stockings
63727 Stockings Tube Videos
Anal Creampie
19551 Anal Creampie Tube Videos
Missionary
17383 Missionary Tube Videos
Car
13966 Car Tube Videos
Animation
11035 Animation Tube Videos
Kitchen
8593 Kitchen Tube Videos
Tits
471846 Tits Tube Videos
Busty
118804 Busty Tube Videos
Solo
115949 Solo Tube Videos
Doggystyle
112561 Doggystyle Tube Videos
Orgy
45774 Orgy Tube Videos
Panties
28885 Panties Tube Videos
Cum Swallowing
19850 Cum Swallowing Tube Videos
Nipples
16371 Nipples Tube Videos
Chinese
8668 Chinese Tube Videos
Spanish
3602 Spanish Tube Videos
Beauty
103470 Beauty Tube Videos
Deepthroat
39491 Deepthroat Tube Videos
Mature Lesbian
37050 Mature Lesbian Tube Videos
Squirt
20247 Squirt Tube Videos
Brazilian
13981 Brazilian Tube Videos
Boss
5702 Boss Tube Videos
Twins
1099 Twins Tube Videos
Pakistani
468 Pakistani Tube Videos
Fucking
669804 Fucking Tube Videos
Group Sex
247158 Group Sex Tube Videos
Femdom
36023 Femdom Tube Videos
Upskirt
14339 Upskirt Tube Videos
Transsexual
13943 Transsexual Tube Videos
Gloryhole
13002 Gloryhole Tube Videos
Turkish
3535 Turkish Tube Videos
Swedish
2697 Swedish Tube Videos
Screaming
2331 Screaming Tube Videos
Enema
611 Enema Tube Videos
Big Tits
368610 Big Tits Tube Videos
Pornstar
119327 Pornstar Tube Videos
Strap On
57467 Strap On Tube Videos
Cfnm
22586 Cfnm Tube Videos
Anus
14621 Anus Tube Videos
Double Fucking
8580 Double Fucking Tube Videos
Golden Shower
2443 Golden Shower Tube Videos
Filipina
1870 Filipina Tube Videos
Prostate
1100 Prostate Tube Videos
Hermaphrodite
134 Hermaphrodite Tube Videos
Latina
94265 Latina Tube Videos
Bondage
35894 Bondage Tube Videos
Small Cock
19156 Small Cock Tube Videos
Office
14960 Office Tube Videos
Rimjob
10615 Rimjob Tube Videos
Submissive
9445 Submissive Tube Videos
Fat Mature
7154 Fat Mature Tube Videos
3d
6433 3d Tube Videos
Secretary
4806 Secretary Tube Videos
Mexican
3394 Mexican Tube Videos
Interview
2334 Interview Tube Videos
Alien
238 Alien Tube Videos
Black
158151 Black Tube Videos
Big Ass
108832 Big Ass Tube Videos
Dildo
97241 Dildo Tube Videos
Sperm
37472 Sperm Tube Videos
Ffm
10252 Ffm Tube Videos
Crossdressing
7859 Crossdressing Tube Videos
Mmf
4944 Mmf Tube Videos
Forest
2675 Forest Tube Videos
Behind The Scenes
1622 Behind The Scenes Tube Videos
Gyno Exam
469 Gyno Exam Tube Videos
Pussy
351091 Pussy Tube Videos
Gorgeous
29945 Gorgeous Tube Videos
Doll
22686 Doll Tube Videos
Pantyhose
17314 Pantyhose Tube Videos
Milk
5742 Milk Tube Videos
Transvestite
5650 Transvestite Tube Videos
Chunky
4585 Chunky Tube Videos
Classroom
2789 Classroom Tube Videos
Saggy Tits
1091 Saggy Tits Tube Videos
Greek
572 Greek Tube Videos
Anal Fisting
12505 Anal Fisting Tube Videos
Lezdom
2351 Lezdom Tube Videos
Pages: 1 2 3 4 5 ... 12153
Today top searches
Search
. Amateur mature wife
. Bbc wife amateur
. Breast milk
. Bus lesbian
. Chinese massage
. Creampie gangbang
. Daily basis
. Desi indian mature aunty
. Ebony skinny teens
. Femdom milking
. Gorgeous granny
. Grandpa granny
. Granny cum mouth
. Granny skinny
. Huge cock rape
. Indian college
. Indian marathi
. Indian nri
. Indian telugu
. Interracial cuckold hubby sucks
. Jamaican
. Japanese hidden cam
. Japanese prison
. Japanese sister
. Lesbian asslick
. Nipples bondage
. Old woman young boy
. Ophelie
. Panty close up
. Shemale high heels
. Submissive mature wife
. Sunny leone fucking
. Teenie rape
. Undress
. Vintage swedish erotica
. Wife cheating husband
. Wife pregnant
. Wrong oops
. Young teen girl fuck dad
. Young vintage
Free porn videos
Hot Pornstars Fucking
Search
A
B
C
D
E
F
G
H
I
J
K
L
M
N
O
P
Q
R
S
T
U
V
W
X
Y
Z
. Agatha Ketenllyn
. Allesandra Show
. Ana Foxxx
. Anabela
. Brad Armstrong
. Chase Evans
. Cookie
. Debbie
. Dixie Daytona
. Felicia Fox
. Ginger Powel
. Ivey
. Jada Fire
. Janet Taylor
. Jasmin Jordan
. Jeny Baby
. Julea London
. Kayden Faye
. Kelly Candy
. Kimmie Khan
. Lady Spyce
. Larra
. Lily Lovette
. Maria Swan
. Mia Hilton
. Nanny
. Nicole Scott
. Roxie
. Susanne Brend
. Sydney Jj
. Tasha Lynn
. Tatum Woods
. Tiffany Rousso
. Vannesa
. Veronika Symon
Top List of Porn Tube Sites
1-40
01Movie Mo
02Video One
03Porno Rama
04Rulertube
05Video You Tube
06Porn Hub Com
07Hairy Tube
08DT Video
09Hot Sex Tube
10Sex Tube Club
11Paris Tube Porn
12Sfico
13Nice Sex Tube
14KeX Tube
15Sex Tube Films
16Youporn.com
17Fuck Cam Videos
18Sex Tube Fuck
19Movs Porn Tube
20Cute Porn TV
21My Retro Tube
22Dildo Xxx Tube
23Matures Fuck Tube
24Pink Dino
25Dwarfs Tube
26Xhamster
27Voyeur Sex Films
28Wife Porno Movies
29Home Private Vids
30Mag Post
31La Xxx Porn
32Matures Naked
33Place of Porn
34Vintage Porn Videos
35Older Mom Tube
36Anal Sex Tube
37XNXX Movies
38Porn Tube Archive
39Moms Xxx Movies/
40Diamond Tubes
41-80
41Fuck Tube Movies
42Hot Milf Clips
43New Sex TV
44Cash Video Tube
45Free Sex Videos
46Live Granny
47Hot Fuck Films
48Dino Tube
49Free Xxx Tube
50Joker Sex Tube
51XiX Porn Tube
52Devils Gals
53Mom Tube Sex
54Beeg Porn Tube
55QoQ Tube
56Beeg Tube
57Mom Sex Tubes
58Mrs Sex Tube
59Anal Sex Tube
60Hard Porn
61Real Asian Porn
62Incredible Asian Sex
63Sexy Sluts
64Xxx Online Porn
65Hardsextube Porn
66Suck Porn Tube
67Xvideos Sex
68Slutty Daddy
69Cum Comes
70Xxx Sex Fuck
71Free Milf Videos
72Free Porn Tube
73Porn Tube Boobs
74Free Sex Tube
75Stolen Wifes
76Xxx Sex Anal
77Naked Boobs Porn
78Sexy Porn Clips
79Fat Fuck Tube
80Filth Matures
81-120
81Boss Video
82Try Free Porn
83Crunk Movies
84Plumper Xxx Videos
85Mr Porn
86Free Moms Sex
87Kinky Gonzo Porn
88Goblins Tube
89Naked Wife Porn
90Porn Setup
91Hq Sex Video
92Hot Homemade Tube
93Free Mommy Porn
94Granny Porn Videos
95Xhamster Porn
96Spy Videos Tubes
97Car Tube Video
98Free Busty Porno
99World Porn Movies
100Best Sex Tube
101Hard Porn
102Matures Nude Tube
103Gonzo Movies
104Mommy Sex Movies
105Stream Sex
106Porn Sun Shine
107Hq Sex Tubes
108Fuck Videos
109Classic Fuck Tube
110Fuck Porn Xxx
111Free Amateur Porn
112KoK Porn Tube
113Fucking Tube Xxx
114Hot Free Xxx
115Free Sex Porn
116Korean Porn Tube
117Granny Sex Movs
118Kaza Porn Tube
119Hq Black Porn
120Sexy Hairy Women
121-160
121Extreme Fetish Videos
122Sexy Tuber Fuck
123Free Porno
124Boobs Xxx Porn
125Mobile Porno Tube
126Hidden Cam Porn
127Xxx Hd Videos
128Squirting Porno
129Hard Homemade Porn
130Bush Pussy
131Mature Videos Porn
132Redtube Porn
133Mature Nude Porn
134Free Porn Tubes
135Flamingo Tube
136AzA Porn Tube
137White Porn Tube
138Dads Sex Videos
139Jizz Tube Porn
140Pornhub
141Best Xxx Fuck
142Fuck Anal Tube
143Porno Videos
144My Xxx Movies
145Ice Porn
146Wow Fuck Tube
147U Xxx Tube
148Hd Porn
149Sex Tube Videos
150May Be Porn
151Free Sex Tube
152Anal Xxx Tube
153Top Fuck Tube
154Moms Fuck
155Pipe Porn Tube
156Mature Free Porn
157Xxx Fuck Porn
158Bbw Fuck Videos
159Xxx Mature Videos
160Free Iphone Porn
161-200
161Best Porn Tube
162Moms Xxx Porn
163Warm Pussy Tube
164Mature Anal Sex
165Hardsextube
166Free Boobs Porn
167Grow Sex Tube
168Xxx Wife Cheats
169Mommy Porno Videos
170Xxx Tube Movies
171All Fuck Tube
172Xvideos Porn
173Dirty Mom Porn
174Korean Xxx Movies
175Free Mature Pornstar
176Free Fuck Porn
177Pornesto
178Brown Xxx Tube
179Mommy Porn Videos
180Perfect Sex Movies
181Lucky Porno Tube
182Sex Tube Sun
183Free Fuck Mom
184Honey Porn Tube
185Funny Moms Tube
186Free Facial
187World Xxx Tube
188Fat Fuck Xxx
189Free Xxx Movies
190Fuck Me Porn
191Oral Sex Movies
192Porn Films Online
193Sweet Girls Tube
194Homemade Videos
195Free Gonzo
196Boobs Sex Videos
197Spy Porn Xxx
198Fat Fuck Movies
199Busty Lesbian Videos
200Granny Xxx Films
We do not own, produce or host the Teen videos displayed on this website.
All of the Teen videos displayed here are hosted by websites that are not under our control
Abuse - Free Porn

Updated Time

Updating   
Friend links: ProxyFire    More...
Site Map 1 2 3 4 5 6 7 8 9 10 20 30 40 50 60 70 80 90 100 110 120 130 140 150 160 170 180 190 200 250 300 350 400 450 500 550 600 610 620 630 640 650 660 670 680 690 700 710 720 730 740 750
TOS | Contact us
© 2009 MyIP.cn Dev by MYIP Elapsed:60.341ms