INSERT INTO sites(host) VALUES('arionmovies.com') 1045: Access denied for user 'www-data'@'localhost' (using password: NO) arionmovies.com Estimated Worth $56,771 - MYIP.NET Website Information
Welcome to MyIP.net!
 Set MYIP as homepage      

  
           

Web Page Information

Title:
Meta Description:
Meta Keywords:
sponsored links:
Links:
Images:
Age:
sponsored links:

Traffic and Estimation

Traffic:
Estimation:

Website Ranks

Alexa Rank:
Google Page Rank:
Sogou Rank:
Baidu Cache:

Search Engine Indexed

Search EngineIndexedLinks
 Google:
 Bing:
 Yahoo!:
 Baidu:
 Sogou:
 Youdao:
 Soso:

Server Data

Web Server:
IP address:    
Location:

Registry information

Registrant:
Email:
ICANN Registrar:
Created:
Updated:
Expires:
Status:
Name Server:
Whois Server:

Alexa Rank and trends

Traffic: Today One Week Avg. Three Mon. Avg.
Rank:
PV:
Unique IP:

More ranks in the world

Users from these countries/regions

Where people go on this site

Alexa Charts

Alexa Reach and Rank

Whois data

Who is arionmovies.com at whois.enom.com





Domain Name:
ARIONMOVIES.COM

Registry Domain ID: 1256466428_DOMAIN_COM-VRSN

Registrar WHOIS Server: whois.enom.com

Registrar URL: www.enom.com

Updated Date: 2014-04-11T04:33:56.00Z

Creation Date: 2007-10-05T07:19:00.00Z

Registrar Registration Expiration Date: 2018-10-05T07:19:00.00Z

Registrar: ENOM, INC.

Registrar IANA ID: 48

Reseller: NAMECHEAP.COM

Domain Status: clientTransferProhibited https://www.icann.org/epp#clientTransferProhibited

Registry Registrant ID:

Registrant Name: JORDY PIETERS

Registrant Organization: N/A

Registrant Street: SERINGSTRAAT 18 APT. 9

Registrant City: EDERVEEN

Registrant State/Province: GELDERLAND

Registrant Postal Code: 6744 WZ

Registrant Country: NL

Registrant Phone: +31.1318571462

Registrant Phone Ext:

Registrant Fax:

Registrant Fax Ext:

Registrant Email: WEB

Registry Admin ID:

Admin Name: JORDY PIETERS

Admin Organization: N/A

Admin Street: SERINGSTRAAT 18 APT. 9

Admin City: EDERVEEN

Admin State/Province: GELDERLAND

Admin Postal Code: 6744 WZ

Admin Country: NL

Admin Phone: +31.1318571462

Admin Phone Ext:

Admin Fax:

Admin Fax Ext:

Admin Email: WEB

Registry Tech ID:

Tech Name: JORDY PIETERS

Tech Organization: N/A

Tech Street: SERINGSTRAAT 18 APT. 9

Tech City: EDERVEEN

Tech State/Province: GELDERLAND

Tech Postal Code: 6744 WZ

Tech Country: NL

Tech Phone: +31.1318571462

Tech Phone Ext:

Tech Fax:

Tech Fax Ext:

Tech Email: WEB

Name Server: ns1.fuckez.com

Name Server: ns2.fuckez.com

DNSSEC: unSigned

Registrar Abuse Contact Email: abuse@enom.com

Registrar Abuse Contact Phone: +1.4252982646

URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/

>>> Last update of WHOIS database: 2014-04-11T04:33:56.00Z <<<



For more information on Whois status codes, please visit https://icann.org/epp





The data in this whois database is provided to you for information

purposes only, that is, to assist you in obtaining information about or

related to a domain name registration record. We make this information

available "as is," and do not guarantee its accuracy. By submitting a

whois query, you agree that you will use this data only for lawful

purposes and that, under no circumstances will you use this data to: (1)

enable high volume, automated, electronic processes that stress or load

this whois database system providing you this information; or (2) allow,

enable, or otherwise support the transmission of mass unsolicited,

commercial advertising or solicitations via direct mail, electronic

mail, or by telephone. The compilation, repackaging, dissemination or

other use of this data is expressly prohibited without prior written

consent from us.



We reserve the right to modify these terms at any time. By submitting

this query, you agree to abide by these terms.

Version 6.3 4/3/2002

Front Page Thumbnail

sponsored links:

Front Page Loading Time

Keyword Hits (Biger,better)

Other TLDs of arionmovies

TLDs Created Expires Registered
.com
.net
.org
.cn
.com.cn
.asia
.mobi

Similar Websites

More...
Alexa鏍囬

Search Engine Spider Emulation

Title:Arion Movies . Com - Free Porn - Sex Tube
Description:Free porn and sex videos available absolutely free on Arion Movies. com! Enter the xxx world of unlimited homemade fuck videos, and you are sure to stay with us for hours!
Keywords:free porn, sex tube, xxx videos, anal sex, indian porn, asian movies
Body:
Arion Movies . Com - Free Porn - Sex Tube
Arion Porn Movies - great website full of never seen before xxx videos available absolutely free! We don't collect old hackneyed videos that you can easily find on any other free resources, but select only the most qualitative clips, which are sure to impress even the most discriminating sex fans. Enter the world of unlimited free porn, and you are sure to stay with us for hours!
Date
-any date-Yesterday2 days ago3 days ago5 days ago6 days agoLast WeekWeek Ago
Length
-any len-0..5 minutes5..20 minutes20..40 minutes40..60 minutes60..90 minutes gt; 90 minutes
Tube
-any tube-HardsextubeHDpornOverThumbsPornerBrosPornHubRedTubeSunPornoTube8VID2CXhamsterXVideosXXXKinKyYobtYouPorn
Age
-all ages-18 year old19 year olddadgrannyinnocentmaturemilfmommothernunschoolgirlsisterteenuniversityvirginyoung
Country
-countries-africanamericanargentinianbrazilianbritishchinesecubanczechdutchegyptianfilipinafinnishfrenchgermangreekhawaiianindianindonesianitalianjapanesekoreanmexicanpakistanipolishrussianspanishswedishthaiturkish
Teen
687183 Teen Tube Videos
Forced
3546 Forced Tube Videos
Mature
355182 Mature Tube Videos
Japanese
98412 Japanese Tube Videos
Big Cock
250279 Big Cock Tube Videos
Perverted
23985 Perverted Tube Videos
Vintage
33961 Vintage Tube Videos
Wife
58549 Wife Tube Videos
Story
4021 Story Tube Videos
Home Made
94468 Home Made Tube Videos
Indian
13170 Indian Tube Videos
Anal
345395 Anal Tube Videos
Old Young
30788 Old Young Tube Videos
Lesbian
204633 Lesbian Tube Videos
Classic
9942 Classic Tube Videos
Bus
4257 Bus Tube Videos
Amateur
711609 Amateur Tube Videos
Shemale
59762 Shemale Tube Videos
Old Man
9628 Old Man Tube Videos
Milf
180887 Milf Tube Videos
Arabian
7638 Arabian Tube Videos
German
25175 German Tube Videos
Russian
65536 Russian Tube Videos
Massage
58535 Massage Tube Videos
Hidden Cam
33891 Hidden Cam Tube Videos
Sleeping
2231 Sleeping Tube Videos
Public
183753 Public Tube Videos
Casting
30568 Casting Tube Videos
18 Year Old
27053 18 Year Old Tube Videos
Italian
8442 Italian Tube Videos
Housewife
19606 Housewife Tube Videos
Bizarre
30976 Bizarre Tube Videos
Doctor
8501 Doctor Tube Videos
Interracial
153816 Interracial Tube Videos
Hairy
122097 Hairy Tube Videos
Compilation
17188 Compilation Tube Videos
Gangbang
39401 Gangbang Tube Videos
Swinger
10830 Swinger Tube Videos
Seduce
18741 Seduce Tube Videos
French
15434 French Tube Videos
Czech
12293 Czech Tube Videos
Retro
3497 Retro Tube Videos
Voyeur
109859 Voyeur Tube Videos
Cuckold
35844 Cuckold Tube Videos
Creampie
72875 Creampie Tube Videos
Cinema
411 Cinema Tube Videos
Ugly
1235 Ugly Tube Videos
Mature Amateur
93215 Mature Amateur Tube Videos
Asian
206831 Asian Tube Videos
Ass
295844 Ass Tube Videos
Handjob
101752 Handjob Tube Videos
Gay
262875 Gay Tube Videos
Surprise
2523 Surprise Tube Videos
Cum In Mouth
32717 Cum In Mouth Tube Videos
Anime
11191 Anime Tube Videos
Cheating
5466 Cheating Tube Videos
Big Natural Tits
24525 Big Natural Tits Tube Videos
Maid
5320 Maid Tube Videos
Beach
11109 Beach Tube Videos
Orgasm
62559 Orgasm Tube Videos
Student
57917 Student Tube Videos
Cash
9521 Cash Tube Videos
Monster Cock
13978 Monster Cock Tube Videos
Sex
610689 Sex Tube Videos
Tranny
72782 Tranny Tube Videos
Spy
11300 Spy Tube Videos
Party
81983 Party Tube Videos
Bdsm
159523 Bdsm Tube Videos
Husband
5615 Husband Tube Videos
Masturbating
350297 Masturbating Tube Videos
Teacher
16088 Teacher Tube Videos
Thai
6399 Thai Tube Videos
Chubby
24988 Chubby Tube Videos
Nudist
18688 Nudist Tube Videos
Nun
712 Nun Tube Videos
Slave
24472 Slave Tube Videos
Webcam
110498 Webcam Tube Videos
Prostitute
25028 Prostitute Tube Videos
Bbw
153794 Bbw Tube Videos
3some
146624 3some Tube Videos
African
12234 African Tube Videos
Egyptian
518 Egyptian Tube Videos
Fisting
21921 Fisting Tube Videos
British
20253 British Tube Videos
Cum
233010 Cum Tube Videos
Outdoor
82686 Outdoor Tube Videos
Big Black Cock
44794 Big Black Cock Tube Videos
Animation
11117 Animation Tube Videos
Fucking
765390 Fucking Tube Videos
Panties
35167 Panties Tube Videos
Flasher
32642 Flasher Tube Videos
Old Young Lesbian
3698 Old Young Lesbian Tube Videos
Hermaphrodite
154 Hermaphrodite Tube Videos
Car
15142 Car Tube Videos
Stockings
70310 Stockings Tube Videos
Pornstar
134979 Pornstar Tube Videos
Strap On
76707 Strap On Tube Videos
Jerking
47952 Jerking Tube Videos
Insertion
12180 Insertion Tube Videos
Rocco
1747 Rocco Tube Videos
Fetish
665313 Fetish Tube Videos
Game
11957 Game Tube Videos
Blowjob
1086332 Blowjob Tube Videos
Tits
516156 Tits Tube Videos
3d
6537 3d Tube Videos
Black
171818 Black Tube Videos
Lesbian Teen
51557 Lesbian Teen Tube Videos
Bisexual
44318 Bisexual Tube Videos
Spanked
15198 Spanked Tube Videos
Turkish
3293 Turkish Tube Videos
Screaming
2583 Screaming Tube Videos
Exhibitionists
2713 Exhibitionists Tube Videos
Doggystyle
140659 Doggystyle Tube Videos
Clit
48668 Clit Tube Videos
Small Cock
22273 Small Cock Tube Videos
Couple
221867 Couple Tube Videos
Dildo
107561 Dildo Tube Videos
Deepthroat
44320 Deepthroat Tube Videos
Nipples
18958 Nipples Tube Videos
Chinese
10208 Chinese Tube Videos
Mexican
3226 Mexican Tube Videos
Swedish
2749 Swedish Tube Videos
Pakistani
533 Pakistani Tube Videos
Busty
133538 Busty Tube Videos
Squirt
20952 Squirt Tube Videos
Mmf
6370 Mmf Tube Videos
Golden Shower
2510 Golden Shower Tube Videos
Latina
98264 Latina Tube Videos
Brazilian
14136 Brazilian Tube Videos
Submissive
11235 Submissive Tube Videos
DPed Anal
7250 DPed Anal Tube Videos
Orgy
60196 Orgy Tube Videos
Boss
6178 Boss Tube Videos
Secretary
5239 Secretary Tube Videos
Pussy
409896 Pussy Tube Videos
Big Tits
400566 Big Tits Tube Videos
Group Sex
280579 Group Sex Tube Videos
Ebony
200397 Ebony Tube Videos
Big Ass
116420 Big Ass Tube Videos
Nude
111738 Nude Tube Videos
Cum Swallowing
31715 Cum Swallowing Tube Videos
Upskirt
14474 Upskirt Tube Videos
Rimjob
11660 Rimjob Tube Videos
Beauty
119001 Beauty Tube Videos
Mature Lesbian
41931 Mature Lesbian Tube Videos
Gloryhole
15432 Gloryhole Tube Videos
Glasses
12892 Glasses Tube Videos
Transvestite
7493 Transvestite Tube Videos
Clothed Sex
2096 Clothed Sex Tube Videos
Saggy Tits
976 Saggy Tits Tube Videos
Missionary
27211 Missionary Tube Videos
Anal Creampie
24993 Anal Creampie Tube Videos
Kitchen
9684 Kitchen Tube Videos
Emo
8211 Emo Tube Videos
Fat Mature
7904 Fat Mature Tube Videos
Spanish
3621 Spanish Tube Videos
Flexible
2831 Flexible Tube Videos
Filipina
1902 Filipina Tube Videos
Solo
125070 Solo Tube Videos
Anus
20533 Anus Tube Videos
Transsexual
16047 Transsexual Tube Videos
Milk
6051 Milk Tube Videos
Forest
2993 Forest Tube Videos
Twins
1251 Twins Tube Videos
Enema
635 Enema Tube Videos
Sperm
54391 Sperm Tube Videos
Bondage
40928 Bondage Tube Videos
Kinky
38849 Kinky Tube Videos
Glamour
38837 Glamour Tube Videos
Doll
29727 Doll Tube Videos
Whip
4899 Whip Tube Videos
Prostate
1216 Prostate Tube Videos
Greek
530 Greek Tube Videos
Alien
274 Alien Tube Videos
Femdom
40647 Femdom Tube Videos
Pantyhose
18470 Pantyhose Tube Videos
Office
16584 Office Tube Videos
Crossdressing
9452 Crossdressing Tube Videos
Gorgeous
37200 Gorgeous Tube Videos
Hogtied
693 Hogtied Tube Videos
Pages: 1 2 3 4 5 ... 12724
Today top searches
Search
. Anal
. Arab teens
. Asian ladyboy handjob
. Asian torture
. Breast milk
. Bus lesbian
. Chuby mature
. Domina shemale
. Downblouse
. Foot fisting
. French mature anal
. Fucking mouth my wifey
. Grandpa granny
. Granny amateur
. Granny outdoor
. Granny vintage
. Hentai torture
. Hollywood celebs sex
. Japanese wife
. Lesbian mature seduce teen girl
. Mature over 40
. Mom caught daughter
. Mom son daughter
. Mother young son
. Old saggy tits
. Orgasm compilation
. Pakistani girls
. Public indian
. Pussy spreading solo
. Real defloration
. Russian vintage
. Schoolgirl bus
. Screw my
. Self bondage
. Teen bate
. Teen pervert
. Teen pigtail
. Tranny old
. Voyeur sex outside
. Wife masturbating
Free porn videos
Hot Pornstars Fucking
Search
A
B
C
D
E
F
G
H
I
J
K
L
M
N
O
P
Q
R
S
T
U
V
W
X
Y
Z
. Alyssa Chase
. Applegate
. Arika Rika
. Christine Roberts
. Dwayne Cummings
. Jayla Dream
. Katya Larina
. Kina
. Kristen Jordan
. Kristina Blonde
. Kyla Quinn
. Leony Aprill
. Lilliane Tiger
. Little Bailey
. Malu
. Marita
. Melena
. Melissa Monet
. Miku Makino
. Morgane
. Nikita Von James
. Nikki Delano
. Nikki Phoenix
. Paola
. Risa Kasumi
. Sabrina Maree
. Sabrina White
. Shell
. Shiori Kamisaki
. Sierra Snow
. Stevens
. Torri Flames
. Wendy Divine
Top List of Porn Tube Sites
1-40
01Porno Rama
02Video One
03Movie Mo
04DT Video
05Live Granny
06Free Moms Sex
07Pink Dino
08Sfico
0921 Pornhub
10Crunk Movies
11Hot Sex Tube
12Kinky Gonzo Porn
13Mag Post
14Sex Tube Club
15Sexy Sluts
16Xxx Sex Anal
17Matures Naked
18Voyeur Sex Films
19Dildo Xxx Tube
20Older Mom Tube
21Pipe Porn Tube
22Porn Tube Boobs
23Rulertube
24Dino Tube
25Dwarfs Tube
26Cash Video Tube
27Place of Porn
28Car Tube Video
29Nice Sex Tube
30Xxx Hd Videos
31Naked Boobs Porn
32Granny Porn Videos
33Mom Tube Sex
34Anal Sex Tube
35Sex Tube Films
36Mature Videos Porn
37Boss Video
38Hairy Tube
39Fuck Anal Tube
40Video You Tube
41-80
41Free Porn Tube
42Kaza Porn Tube
43QoQ Tube
44Filth Matures
45Sex Tube Videos
46Hirsute Porn Legs
47Xhamster Porn
48XNXX Movies
49Free Milf Videos
50Stolen Wifes
51Suck Porn Tube
52Homemade Videos
53Tapir Porn Tube
54Mommy Sex Movies
55Fat Fuck Tube
56Plumper Xxx Videos
57Matures Fuck Tube
58KeX Tube
59Vintage Porn Videos
60Porn Tube Archive
61Moms Fuck
62Tranny Xxx Tube
63Goblins Tube
64Cute Porn TV
65Gonzo Movies
66Asian Porn Videos
67My Xxx Movies
68Redtube Porn
69Boobs Sex Videos
70Sex Tube Fuck
71Youporn.com
72Home Private Vids
73Free Sexy Porno
74Free Sex Tube
75Hard Homemade Porn
76Xvideos Sex
77Hardsextube Porn
78HuK Tube
79Naked Wife Porn
80Mr Porn
81-120
81Hd Porn
82Devils Gals
83World Porn Movies
84Cum Comes
85Best Xxx Fuck
86Paris Tube Porn
87Free Amateur Porn
88Slutty Daddy
89White Porn Tube
90Free Iphone Sex
91Free Sex Porn
92Free Porn Tubes
93Mature Nude Porn
94My Retro Tube
95KoK Porn Tube
96Free Busty Porno
97Stream Sex
98Hq Sex Video
99Flamingo Tube
100Bbw Fuck Videos
101Dads Sex Videos
102Beeg Tube
103Xvideos Porn
104I Free Porn
105Grow Sex Tube
106Diamond Tubes
107African Xxx Movies
108Classic Fuck Tube
109Spy Videos Tubes
110Free Hd Erotic
111Hot Fuck Films
112XiX Porn Tube
113Hard Porn
114Free Mature Sex
115Best Sex Tube
116Hq Sex Tubes
117Anal Sex Tube
118Xxx Tube Movies
119Free Homemade Fuck
120La Xxx Porn
121-160
121Joker Sex Tube
122Milf Fuck
123Extreme Fetish Videos
124Wife Porno Movies
125Matures Nude Tube
126Xxx Fuck Porn
127Xxx Tube List
128Warm Pussy Tube
129Outdoor Porn Videos
130Hq Mature Fuck
131May Be Porn
132Hard Porn
133Porno Videos
134Pussy Secret Sex
135Free Iphone Porn
136Cheating Wives Porn
137Best Mobile Sex
138Live Porn Videos
139Xxx Mature Videos
140Mature Ass Fucked
141Milf Sex Clips
142Mature Sex Clips
143Public Porn Clips
144Japanese Sex Videos
145Best Porn Tube
146Free Wife Xxx
147Moms And Dads
148Anal Porn Videos
149Mobile Porno Tube
150Mature Free Porn
151Amateur Videos Porn
152Ass Porno Clips
153Creampie Gangbang Sex
154Vibrator Porn Tube
155Bbw Tubes Porn
156Squirting Porno
157Real Asian Porn
158Mature Fuck Videos
159Hq Sex Movies
160Live Porn Films
161-200
161Brazilian Free Sex
162Milf Anal Tube
163Sexy Tuber Fuck
164Korean Sex Movies
165Wife Xxx Porn
166Hardcore Tube Porn
167Free Sex Movies
168Mom Sex Tubes
169Hot Free Xxx
170Extra Milf Porn
171Hot Lesbian Porn
172Fuck Porn Xxx
173Hot Fuck Webcam
174Fuck Cam Videos
175Porn Livesex Online
176Indian Sex Movies
177Vip Porn Cams
178Free Hard Porn
179Hd Sex Tubes
180All Sex Tubes
181Free Sex Porno
182Free Mom Fuck
183Fresh Asian Porn
184Hairy Mobile Porno
185Moms Xxx Movies/
186Xxx Tube Videos
187Free Fuck Porn
188Dirty Mom Porn
189Free Mature Pornstar
190Forbidden Moms Porn
191Korean Xxx Movies
192Moms Xxx Porn
193Hq Black Porn
194All Milf Porn
195Asian Free Porns
196Mature Free Porn
197Gangbang Movies Porn
198Old Women Porn
199Xxx Porn Videos
200Mature Anal Sex
We do not own, produce or host the Teen videos displayed on this website.
All of the Teen videos displayed here are hosted by websites that are not under our control
Abuse - Free Porn

Updated Time

Updating   
Friend links: ProxyFire    More...
Site Map 1 2 3 4 5 6 7 8 9 10 20 30 40 50 60 70 80 90 100 110 120 130 140 150 160 170 180 190 200 250 300 350 400 450 500 550 600 610 620 630 640 650 660 670 680 690 700 710 720 730 740 750
TOS | Contact us
© 2009 MyIP.cn Dev by MYIP Elapsed:46.899ms