INSERT INTO sites(host) VALUES('arionmovies.com') 1045: Access denied for user 'www-data'@'localhost' (using password: NO) arionmovies.com Estimated Worth $133,276 - MYIP.NET Website Information
Welcome to MyIP.net!
 Set MYIP as homepage      

  
           

Web Page Information

Title:
Meta Description:
Meta Keywords:
sponsored links:
Links:
Images:
Age:
sponsored links:

Traffic and Estimation

Traffic:
Estimation:

Website Ranks

Alexa Rank:
Google Page Rank:
Sogou Rank:
Baidu Cache:

Search Engine Indexed

Search EngineIndexedLinks
 Google:
 Bing:
 Yahoo!:
 Baidu:
 Sogou:
 Youdao:
 Soso:

Server Data

Web Server:
IP address:    
Location:

Registry information

Registrant:
Email:
ICANN Registrar:
Created:
Updated:
Expires:
Status:
Name Server:
Whois Server:

Alexa Rank and trends

Traffic: Today One Week Avg. Three Mon. Avg.
Rank:
PV:
Unique IP:

More ranks in the world

Users from these countries/regions

Where people go on this site

Alexa Charts

Alexa Reach and Rank

Whois data

Who is arionmovies.com at com.whois-servers.net

Domain Name: ARIONMOVIES.COM

Registry Domain ID: 1256466428_DOMAIN_COM-VRSN

Registrar WHOIS Server: whois.namecheap.com

Registrar URL: http://www.namecheap.com

Updated Date: 2018-01-08T16:13:56Z

Creation Date: 2007-10-05T07:19:25Z

Registry Expiry Date: 2018-10-05T07:19:25Z

Registrar: NameCheap Inc.

Registrar IANA ID: 1068

Registrar Abuse Contact Email: abuse

Registrar Abuse Contact Phone: +1.6613102107

Domain Status: ok https://icann.org/epp#ok

Name Server: ns1.fuckez.com

Name Server: ns2.fuckez.com

DNSSEC: unsigned

URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/

>>> Last update of whois database: 2018-01-19T08:27:49Z <<<



For more information on Whois status codes, please visit https://icann.org/epp



NOTICE:
The expiration date displayed in this record is the date the

registrar's sponsorship of the domain name registration in the registry is

currently set to expire. This date does not necessarily reflect the expiration

date of the domain name registrant's agreement with the sponsoring

registrar. Users may consult the sponsoring registrar's Whois database to

view the registrar's reported date of expiration for this registration.



TERMS OF USE:
You are not authorized to access or query our Whois

database through the use of electronic processes that are high-volume and

automated except as reasonably necessary to register domain names or

modify existing registrations; the Data in VeriSign Global Registry

Services' ("VeriSign") Whois database is provided by VeriSign for

information purposes only, and to assist persons in obtaining information

about or related to a domain name registration record. VeriSign does not

guarantee its accuracy. By submitting a Whois query, you agree to abide

by the following terms of use: You agree that you may use this Data only

for lawful purposes and that under no circumstances will you use this Data

to:
(1) allow, enable, or otherwise support the transmission of mass

unsolicited, commercial advertising or solicitations via e-mail, telephone,

or facsimile; or (2) enable high volume, automated, electronic processes

that apply to VeriSign (or its computer systems). The compilation,

repackaging, dissemination or other use of this Data is expressly

prohibited without the prior written consent of VeriSign. You agree not to

use electronic processes that are automated and high-volume to access or

query the Whois database except as reasonably necessary to register

domain names or modify existing registrations. VeriSign reserves the right

to restrict your access to the Whois database in its sole discretion to ensure

operational stability. VeriSign may restrict or terminate your access to the

Whois database for failure to abide by these terms of use. VeriSign

reserves the right to modify these terms at any time.



The Registry database contains ONLY .COM, .NET, .EDU domains and

Registrars.

Front Page Thumbnail

sponsored links:

Front Page Loading Time

Keyword Hits (Biger,better)

Other TLDs of arionmovies

TLDs Created Expires Registered
.com
.net
.org
.cn
.com.cn
.asia
.mobi

Similar Websites

More...
Alexa鏍囬

Search Engine Spider Emulation

Title:Arion Movies . Com - Free Porn - Sex Tube
Description:Free porn and sex videos available absolutely free on Arion Movies. com! Enter the xxx world of unlimited homemade fuck videos, and you are sure to stay with us for hours!
Keywords:free porn, sex tube, xxx videos, anal sex, indian porn, asian movies
Body:
Arion Movies . Com - Free Porn - Sex Tube
Arion Porn Movies - great website full of never seen before xxx videos available absolutely free! We don't collect old hackneyed videos that you can easily find on any other free resources, but select only the most qualitative clips, which are sure to impress even the most discriminating sex fans. Enter the world of unlimited free porn, and you are sure to stay with us for hours!
Date
-any date-Yesterday2 days ago3 days ago4 days ago5 days ago6 days agoLast WeekWeek Ago
Length
-any len-0..5 minutes5..20 minutes20..40 minutes40..60 minutes60..90 minutes gt; 90 minutes
Tube
-any tube-HardsextubeHDpornOverThumbsPornerBrosPornHubRedTubeSunPornoTube8VID2CXhamsterXVideosXXXKinKyYobtYouPorn
Age
-all ages-18 year old19 year olddadgrannyinnocentmaturemilfmommothernunschoolgirlsisterteenuniversityvirginyoung
Country
-countries-africanamericanargentinianbrazilianbritishchinesecubanczechdutchegyptianfilipinafinnishfrenchgermangreekhawaiianindianindonesianitalianjapanesekoreanmexicanpakistanipolishrussianspanishswedishthaiturkish
Old Young
29242 Old Young Tube Videos
Mature
344712 Mature Tube Videos
Vintage
33889 Vintage Tube Videos
Teen
654377 Teen Tube Videos
Wife
57038 Wife Tube Videos
Home Made
77444 Home Made Tube Videos
Japanese
95592 Japanese Tube Videos
Forced
2506 Forced Tube Videos
Lesbian
189450 Lesbian Tube Videos
Surprise
2339 Surprise Tube Videos
Anal
319151 Anal Tube Videos
Compilation
17732 Compilation Tube Videos
Massage
54386 Massage Tube Videos
Old Man
7935 Old Man Tube Videos
Pakistani
513 Pakistani Tube Videos
Mature Amateur
90364 Mature Amateur Tube Videos
Arabian
8393 Arabian Tube Videos
Russian
59339 Russian Tube Videos
Interracial
137682 Interracial Tube Videos
Shemale
61469 Shemale Tube Videos
Hairy
103236 Hairy Tube Videos
Nudist
18549 Nudist Tube Videos
Cuckold
26648 Cuckold Tube Videos
Slave
21417 Slave Tube Videos
Tiny
16279 Tiny Tube Videos
Casting
21110 Casting Tube Videos
Swinger
10806 Swinger Tube Videos
Orgasm
53218 Orgasm Tube Videos
Hidden Cam
35100 Hidden Cam Tube Videos
French
15585 French Tube Videos
Seduce
16144 Seduce Tube Videos
18 Year Old
21760 18 Year Old Tube Videos
Cheating
5713 Cheating Tube Videos
Bisexual
24243 Bisexual Tube Videos
Gangbang
34878 Gangbang Tube Videos
African
11933 African Tube Videos
Exhibitionists
1979 Exhibitionists Tube Videos
Amateur
682579 Amateur Tube Videos
Bus
3963 Bus Tube Videos
Italian
8555 Italian Tube Videos
German
25981 German Tube Videos
Creampie
67052 Creampie Tube Videos
Milf
175998 Milf Tube Videos
Chubby
23848 Chubby Tube Videos
Lesbian Teen
46869 Lesbian Teen Tube Videos
Big Natural Tits
18757 Big Natural Tits Tube Videos
Indian
13443 Indian Tube Videos
Story
3348 Story Tube Videos
Whip
4692 Whip Tube Videos
Amputee
67 Amputee Tube Videos
Spanked
14643 Spanked Tube Videos
Voyeur
108855 Voyeur Tube Videos
Sleeping
1893 Sleeping Tube Videos
Handjob
90842 Handjob Tube Videos
Monster Cock
9555 Monster Cock Tube Videos
Crossdressing
7915 Crossdressing Tube Videos
Beach
10927 Beach Tube Videos
Masturbating
341274 Masturbating Tube Videos
Midget
1072 Midget Tube Videos
Classic
9551 Classic Tube Videos
3some
133292 3some Tube Videos
Public
168960 Public Tube Videos
Retro
3360 Retro Tube Videos
Housewife
16727 Housewife Tube Videos
Chinese
8556 Chinese Tube Videos
Old Young Lesbian
2536 Old Young Lesbian Tube Videos
Mexican
3635 Mexican Tube Videos
10+ Inch Cock
1499 10+ Inch Cock Tube Videos
Prostitute
13079 Prostitute Tube Videos
Webcam
117809 Webcam Tube Videos
Mistress
24104 Mistress Tube Videos
Bbw
140358 Bbw Tube Videos
Egyptian
606 Egyptian Tube Videos
Bdsm
146086 Bdsm Tube Videos
Spy
10687 Spy Tube Videos
Deepthroat
40550 Deepthroat Tube Videos
Blowjob
1005324 Blowjob Tube Videos
Czech
11475 Czech Tube Videos
Filipina
1933 Filipina Tube Videos
DPed Anal
6461 DPed Anal Tube Videos
Sissy
2918 Sissy Tube Videos
Party
68880 Party Tube Videos
Screaming
2318 Screaming Tube Videos
Gay
263443 Gay Tube Videos
Animation
11002 Animation Tube Videos
Squirt
20870 Squirt Tube Videos
Couple
201775 Couple Tube Videos
Orgy
45030 Orgy Tube Videos
Transsexual
14487 Transsexual Tube Videos
Asian
203991 Asian Tube Videos
Doctor
8406 Doctor Tube Videos
Humiliation
16487 Humiliation Tube Videos
Boss
5837 Boss Tube Videos
Panties
28374 Panties Tube Videos
Hermaphrodite
130 Hermaphrodite Tube Videos
Bukkake
17829 Bukkake Tube Videos
Doggystyle
112327 Doggystyle Tube Videos
Husband
5406 Husband Tube Videos
Fisting
21105 Fisting Tube Videos
Submissive
9468 Submissive Tube Videos
Barely Legal
18440 Barely Legal Tube Videos
Thai
6344 Thai Tube Videos
Mature Lesbian
37084 Mature Lesbian Tube Videos
Hypnotized
175 Hypnotized Tube Videos
Game
10049 Game Tube Videos
Natural Boobs
13035 Natural Boobs Tube Videos
3d
6421 3d Tube Videos
Aged
8550 Aged Tube Videos
Gloryhole
13131 Gloryhole Tube Videos
Insertion
9310 Insertion Tube Videos
Adultery
5877 Adultery Tube Videos
Cumshot
179347 Cumshot Tube Videos
Nipples
16707 Nipples Tube Videos
Asslick
1079 Asslick Tube Videos
Brazilian
14145 Brazilian Tube Videos
Pantyhose
17280 Pantyhose Tube Videos
Stockings
63775 Stockings Tube Videos
Saggy Tits
1231 Saggy Tits Tube Videos
Rocco
1562 Rocco Tube Videos
Turkish
3778 Turkish Tube Videos
Fucking
665432 Fucking Tube Videos
Maid
5207 Maid Tube Videos
Big Black Cock
41442 Big Black Cock Tube Videos
Stripper
39957 Stripper Tube Videos
Perverted
19648 Perverted Tube Videos
Sauna
973 Sauna Tube Videos
British
18658 British Tube Videos
Dancing
13643 Dancing Tube Videos
Anal Creampie
19434 Anal Creampie Tube Videos
Huge Cock
67734 Huge Cock Tube Videos
Old Farts
1745 Old Farts Tube Videos
Reverse Gangbang
127 Reverse Gangbang Tube Videos
Spring Break
355 Spring Break Tube Videos
Crying
378 Crying Tube Videos
Dildo
97261 Dildo Tube Videos
Hardcore
694203 Hardcore Tube Videos
Nun
666 Nun Tube Videos
Short Hair
2593 Short Hair Tube Videos
Oldy
5120 Oldy Tube Videos
Missionary
17203 Missionary Tube Videos
Dped
11801 Dped Tube Videos
Mature Teacher
2799 Mature Teacher Tube Videos
Ffm
9895 Ffm Tube Videos
Double Blowjob
15397 Double Blowjob Tube Videos
Footjob
8766 Footjob Tube Videos
Teacher
14781 Teacher Tube Videos
American
5074 American Tube Videos
Tied Up
4971 Tied Up Tube Videos
Lap Dancing
420 Lap Dancing Tube Videos
Cheerleader
4928 Cheerleader Tube Videos
Pov
94738 Pov Tube Videos
Cute
82788 Cute Tube Videos
Swedish
2680 Swedish Tube Videos
Hd
101045 Hd Tube Videos
Stupid Girl
35 Stupid Girl Tube Videos
Interview
2364 Interview Tube Videos
Vaginal Cumshot
2034 Vaginal Cumshot Tube Videos
Watersport
2635 Watersport Tube Videos
Outdoor
75712 Outdoor Tube Videos
Nature
33613 Nature Tube Videos
Mmf
4899 Mmf Tube Videos
Audition
11959 Audition Tube Videos
Greek
631 Greek Tube Videos
Milk
5845 Milk Tube Videos
Solo
116224 Solo Tube Videos
Swimsuit
682 Swimsuit Tube Videos
Bra
3209 Bra Tube Videos
Nerdy
4300 Nerdy Tube Videos
Flasher
27862 Flasher Tube Videos
Tranny
75026 Tranny Tube Videos
Tits
476809 Tits Tube Videos
Smoking
7036 Smoking Tube Videos
Anal Toying
30596 Anal Toying Tube Videos
Freckled
769 Freckled Tube Videos
Latina
96183 Latina Tube Videos
Feet
33388 Feet Tube Videos
Kissing
33263 Kissing Tube Videos
Big Nipples
7148 Big Nipples Tube Videos
Corset
815 Corset Tube Videos
Cash
7579 Cash Tube Videos
Pages: 1 2 3 4 5 ... 12276
Today top searches
Search
. 90s
. Amateur mature wife
. Amature wife
. Bangladeshi
. Brother sister
. Daughter dad
. Desi indian mature aunty
. Family taboo
. Forced anal
. Forced sex young girls rape
. Friend fucks my wife
. Grandpa granny
. Granny skinny
. Hairy mom son
. Indian actress
. Indian aunty
. Indian housewife
. Indian marathi
. Indian telugu
. Iranian
. Japanese massage hidden camera
. Japanese mom son
. Kannada
. Lesbian mom daughter
. Mature 50
. Milk tits asian
. Mom fucking son
. Mom seduces daughter
. Mother young son
. Old saggy tits
. Old woman young boy
. Russian granny
. Schoolgirls spanked
. Self bondage
. Spy hairy
. Tamil
. Teen bate
. Teen strip webcam
. Very little girls
. Vintage black white
Free porn videos
Hot Pornstars Fucking
Search
A
B
C
D
E
F
G
H
I
J
K
L
M
N
O
P
Q
R
S
T
U
V
W
X
Y
Z
. Abbraxa
. Akiko Kano
. Aleia Tyler
. Alicia Rio
. Aliyah Yi
. Alyssa Milano
. Amy Moore
. Austin Kincaid
. Ayden James
. Betsabe
. Brandon Lewis
. Dominiko
. Emy
. Fuuka Takanashi
. Geremias
. Jennifer Linda
. Juliette
. Kayla Green
. Kittie
. Mazzy
. Nevaeh Givens
. Nyrobi Knight
. Payton Simmons
. Piper Parker
. Puma Swede
. Rebecca Riley
. Sandra Kay
. Sandra Scream
. Sanne
. Sara Vandella
. Simone Staxxx
. Susan Ayn
. Sylvia Saint
. Teagan
. Tiffany
. Vanessa Paradis
. Yui Natsume
Top List of Porn Tube Sites
1-40
01Movie Mo
02Video One
03Nice Sex Tube
04DT Video
05Hot Sex Tube
0621 Pornhub
07Sex Tube Fuck
08Free Xxx Clips
09New Sex TV
10Naked Wife Porn
11Kinky Gonzo Porn
12Video You Tube
13Hot Milf Clips
14Hairy Tube
15Xxx Tube Movies
16Mag Post
17Porno Rama
18Sfico
19Hard Porn
20Sex Tube Films
21Gonzo Movies
22Pink Dino
23Rulertube
24My Retro Tube
25Porn Hub Com
26Ice Porn
27Free Sex Tube
28Mr Porn
29Free Porn Tube
30Mom Tube Sex
31KeX Tube
32Crunk Movies
33U Xxx Tube
34Hard Porn
35Mommy Sex Movies
36Best Sex Tube
37Free Milf Videos
38Free Porno
39Stolen Wifes
40Place of Porn
41-80
41Anal Xxx Tube
42Goblins Tube
43Dildo Xxx Tube
44Devils Gals
45Xhamster Porn
46Fuck Tube Movies
47Porno Videos
48Try Free Porn
49Hd Porn
50Matures Naked
51Mature Nude Porn
52Dwarfs Tube
53QoQ Tube
54Filth Matures
55Car Tube Video
56Sexy Sluts
57Hot Fuck Films
58Xxx Sex Anal
59Free Moms Sex
60Best Porn Tube
61Porn Setup
62Real Asian Porn
63Mommy Porn Videos
64Mature Free Porn
65Cash Video Tube
66Youporn.com
67Free Porn Tubes
68Beeg Porn Tube
69Redtube Porn
70World Porn Movies
71Xxx Online Porn
72Hq Black Porn
73Mature Anal Sex
74Mature Videos Porn
75Spy Videos Tubes
76Korean Porn Tube
77Perfect Sex Movies
78Free Fuck Mom
79Moms Fuck
80Mommy Porno Videos
81-120
81Suck Porn Tube
82Matures Fuck Tube
83Free Mature Pornstar
84Korean Xxx Movies
85XiX Porn Tube
86Stream Sex
87Slutty Daddy
88Kaza Porn Tube
89Pipe Porn Tube
90Dads Sex Videos
91Sex Tube Club
92Xxx Sex Fuck
93Voyeur Sex Films
94Pornesto
95Cum Comes
96Movs Porn Tube
97Pornhub
98Mommy Fuck Tube
99Xxx Matures Tube
100Wife Porno Movies
101Porn Tube Archive
102Tube Xxx Porn
103Fuck Videos
104Free Porn Tube
105Free Online Porn
106Busty Porn Models
107Xxx Tube Free
108Moms Xxx Porn
109Xxx Tube Host
110Hq Sex Tubes
111Nude Gonzo Porn
112Free Iphone Porn
113Porn Sun Shine
114Tube Home Porn
115Sexy Tuber Fuck
116Real Japan Porn
117Hardcore Xxx Tube
118Fuck Porn Xxx
119Free Sex Xxx
120Free Fuck Porn
121-160
121Free Hd Porn
122Porn I Wank
123Hardcore Tube Porn
124Free Pornstars Top
125Japan Hd Porn
126Free Latin Porn
127Anal Sex Films
128Moms Xxx Movies/
129Hot Free Xxx
130Bbw Porn Tube
131Lesbian Mature Porn
132Granny Sex Movs
133Asian Homevideo Porn
134Anal Sex Tube
135My Xxx Movies
136La Xxx Porn
137Wow Fuck Tube
138Free Sex Videos
139All Fuck Tube
140Anal Sex Tube
141Cute Porn TV
142Dino Tube
143Xxx Fuck Porn
144Porn Tube Boobs
145Home Private Vids
146Diamond Tubes
147Tapir Porn Tube
148AzA Porn Tube
149Flamingo Tube
150Free Gonzo
151XNXX Movies
152Perky Wives
153Sweet Girls Tube
154Live Granny
155KoK Porn Tube
156Public Porn Clips
157Sexy Porn Clips
158Extreme Fetish Videos
159Boss Video
160Homemade Videos
161-200
161Free Amateur Porn
162Older Mom Tube
163Granny Porn Videos
164Beeg Tube
165Hardsextube Porn
166Vintage Porn Videos
167Bbw Fuck Videos
168Plumper Xxx Videos
169Free Xxx Movies
170Fat Fuck Tube
171Xvideos Sex
172White Porn Tube
173Wife Porn Tube
174Paris Tube Porn
175Jizz Tube Porn
176Best Xxx Fuck
177Xhamster
178Mrs Sex Tube
179
180
181
182
183
184
185
186
187
188
189
190
191
192
193
194
195
196
197
198
199
200
We do not own, produce or host the Teen videos displayed on this website.
All of the Teen videos displayed here are hosted by websites that are not under our control
Abuse - Free Porn

Updated Time

Updating   
Friend links: ProxyFire    More...
Site Map 1 2 3 4 5 6 7 8 9 10 20 30 40 50 60 70 80 90 100 110 120 130 140 150 160 170 180 190 200 250 300 350 400 450 500 550 600 610 620 630 640 650 660 670 680 690 700 710 720 730 740 750
TOS | Contact us
© 2009 MyIP.cn Dev by MYIP Elapsed:23.011ms