INSERT INTO sites(host) VALUES('arionmovies.com') 1045: Access denied for user 'www-data'@'localhost' (using password: NO) arionmovies.com Estimated Worth $331,268 - MYIP.NET Website Information
Welcome to MyIP.net!
 Set MYIP as homepage      

  
           

Web Page Information

Title:
Meta Description:
Meta Keywords:
sponsored links:
Links:
Images:
Age:
sponsored links:

Traffic and Estimation

Traffic:
Estimation:

Website Ranks

Alexa Rank:
Google Page Rank:
Sogou Rank:
Baidu Cache:

Search Engine Indexed

Search EngineIndexedLinks
 Google:
 Bing:
 Yahoo!:
 Baidu:
 Sogou:
 Youdao:
 Soso:

Server Data

Web Server:
IP address:    
Location:

Registry information

Registrant:
Email:
ICANN Registrar:
Created:
Updated:
Expires:
Status:
Name Server:
Whois Server:

Alexa Rank and trends

Traffic: Today One Week Avg. Three Mon. Avg.
Rank:
PV:
Unique IP:

More ranks in the world

Users from these countries/regions

Where people go on this site

Alexa Charts

Alexa Reach and Rank

Whois data

Who is arionmovies.com at com.whois-servers.net

Domain Name: ARIONMOVIES.COM

Registry Domain ID: 1256466428_DOMAIN_COM-VRSN

Registrar WHOIS Server: whois.enom.com

Registrar URL:
http://www.enom.com

Updated Date: 2017-03-06T16:16:50Z

Creation Date: 2007-10-05T07:19:25Z

Registry Expiry Date: 2018-10-05T07:19:25Z

Registrar: eNom, Inc.

Registrar IANA ID: 48

Registrar Abuse Contact Email:

Registrar Abuse Contact Phone:

Domain Status: clientTransferProhibited
https://icann.org/epp#clientTransferProhibited

Name Server:
ns1.fuckez.com

Name Server:
ns2.fuckez.com

DNSSEC: unsigned

URL of the ICANN Whois Inaccuracy Complaint Form:
https://www.icann.org/wicf/

>>> Last update of whois database: 2017-10-07T08:56:08Z <<<



For more information on Whois status codes, please visit
https://icann.org/epp



NOTICE:
The expiration date displayed in this record is the date the

registrar's sponsorship of the domain name registration in the registry is

currently set to expire. This date does not necessarily reflect the expiration

date of the domain name registrant's agreement with the sponsoring

registrar. Users may consult the sponsoring registrar's Whois database to

view the registrar's reported date of expiration for this registration.



TERMS OF USE:
You are not authorized to access or query our Whois

database through the use of electronic processes that are high-volume and

automated except as reasonably necessary to register domain names or

modify existing registrations; the Data in VeriSign Global Registry

Services' ("VeriSign") Whois database is provided by VeriSign for

information purposes only, and to assist persons in obtaining information

about or related to a domain name registration record. VeriSign does not

guarantee its accuracy. By submitting a Whois query, you agree to abide

by the following terms of use: You agree that you may use this Data only

for lawful purposes and that under no circumstances will you use this Data

to:
(1) allow, enable, or otherwise support the transmission of mass

unsolicited, commercial advertising or solicitations via e-mail, telephone,

or facsimile; or (2) enable high volume, automated, electronic processes

that apply to VeriSign (or its computer systems). The compilation,

repackaging, dissemination or other use of this Data is expressly

prohibited without the prior written consent of VeriSign. You agree not to

use electronic processes that are automated and high-volume to access or

query the Whois database except as reasonably necessary to register

domain names or modify existing registrations. VeriSign reserves the right

to restrict your access to the Whois database in its sole discretion to ensure

operational stability. VeriSign may restrict or terminate your access to the

Whois database for failure to abide by these terms of use. VeriSign

reserves the right to modify these terms at any time.



The Registry database contains ONLY .COM, .NET, .EDU domains and

Registrars.

Front Page Thumbnail

sponsored links:

Front Page Loading Time

Keyword Hits (Biger,better)

Other TLDs of arionmovies

TLDs Created Expires Registered
.com
.net
.org
.cn
.com.cn
.asia
.mobi

Similar Websites

More...
Alexa鏍囬

Search Engine Spider Emulation

Title:Arion Movies . Com - Free Porn - Sex Tube
Description:Free porn and sex videos available absolutely free on Arion Movies. com! Enter the xxx world of unlimited homemade fuck videos, and you are sure to stay with us for hours!
Keywords:free porn, sex tube, xxx videos, anal sex, indian porn, asian movies
Body:
Arion Movies . Com - Free Porn - Sex Tube
Arion Porn Movies - great website full of never seen before xxx videos available absolutely free! We don't collect old hackneyed videos that you can easily find on any other free resources, but select only the most qualitative clips, which are sure to impress even the most discriminating sex fans. Enter the world of unlimited free porn, and you are sure to stay with us for hours!
Date
-any date-Yesterday2 days ago3 days ago4 days ago5 days ago6 days agoLast WeekWeek Ago
Length
-any len-0..5 minutes5..20 minutes20..40 minutes40..60 minutes60..90 minutes gt; 90 minutes
Tube
-any tube-HardsextubeHDpornOverThumbsPornerBrosPornHubRedTubeSunPornoTube8VID2CXhamsterXVideosXXXKinKyYobtYouPorn
Age
-all ages-18 year old19 year olddadgrannyinnocentmaturemilfmommothernunschoolgirlsisterteenuniversityvirginyoung
Country
-countries-africanamericanargentinianbrazilianbritishchinesecubanczechdutchegyptianfilipinafinnishfrenchgermangreekhawaiianindianindonesianitalianjapanesekoreanmexicanpakistanipolishrussianspanishswedishthaiturkish
Young
93350 Young Tube Videos
Teen
653706 Teen Tube Videos
Mature
341697 Mature Tube Videos
Forced
2527 Forced Tube Videos
Home Made
78173 Home Made Tube Videos
Vintage
33395 Vintage Tube Videos
Perverted
19717 Perverted Tube Videos
Japanese
95839 Japanese Tube Videos
Story
3339 Story Tube Videos
First Time
27578 First Time Tube Videos
Wife
55857 Wife Tube Videos
Creampie
66515 Creampie Tube Videos
Indian
13197 Indian Tube Videos
Old Young
28243 Old Young Tube Videos
Lesbian
189651 Lesbian Tube Videos
Anal
319331 Anal Tube Videos
Shemale
60185 Shemale Tube Videos
Massage
54432 Massage Tube Videos
Russian
59050 Russian Tube Videos
Petite
43019 Petite Tube Videos
Classic
9516 Classic Tube Videos
German
25388 German Tube Videos
18 Year Old
21973 18 Year Old Tube Videos
Hidden Cam
34477 Hidden Cam Tube Videos
Seduce
16471 Seduce Tube Videos
Casting
22009 Casting Tube Videos
Compilation
17431 Compilation Tube Videos
Milf
174207 Milf Tube Videos
Babysitter
4972 Babysitter Tube Videos
Arabian
8081 Arabian Tube Videos
Amateur
677706 Amateur Tube Videos
Bus
3960 Bus Tube Videos
Interracial
138455 Interracial Tube Videos
Surprise
2342 Surprise Tube Videos
Old Man
8120 Old Man Tube Videos
Housewife
16899 Housewife Tube Videos
Public
169005 Public Tube Videos
French
15212 French Tube Videos
Hairy
103929 Hairy Tube Videos
Gangbang
34889 Gangbang Tube Videos
Retro
3275 Retro Tube Videos
Gay
260342 Gay Tube Videos
Italian
8569 Italian Tube Videos
Slave
21238 Slave Tube Videos
Swinger
10702 Swinger Tube Videos
Sleeping
1892 Sleeping Tube Videos
Hentai
18496 Hentai Tube Videos
Orgasm
53394 Orgasm Tube Videos
Cuckold
27339 Cuckold Tube Videos
Voyeur
107203 Voyeur Tube Videos
Mature Amateur
89344 Mature Amateur Tube Videos
Monster Cock
10005 Monster Cock Tube Videos
Big Natural Tits
18012 Big Natural Tits Tube Videos
Asian Teen
34813 Asian Teen Tube Videos
Beach
10767 Beach Tube Videos
Bdsm
145083 Bdsm Tube Videos
Bizarre
25034 Bizarre Tube Videos
Masturbating
338098 Masturbating Tube Videos
Thai
6275 Thai Tube Videos
Webcam
114848 Webcam Tube Videos
Handjob
89893 Handjob Tube Videos
Teacher
14940 Teacher Tube Videos
Cum In Mouth
20306 Cum In Mouth Tube Videos
Game
10273 Game Tube Videos
Doctor
8323 Doctor Tube Videos
Cinema
370 Cinema Tube Videos
Maid
5142 Maid Tube Videos
Skinny
39152 Skinny Tube Videos
Czech
11487 Czech Tube Videos
Cartoon
12959 Cartoon Tube Videos
Cheating
5497 Cheating Tube Videos
Cash
7796 Cash Tube Videos
Ass
269176 Ass Tube Videos
Bbw
139990 Bbw Tube Videos
3some
133751 3some Tube Videos
Asian
203112 Asian Tube Videos
Husband
5366 Husband Tube Videos
Old Young Lesbian
2471 Old Young Lesbian Tube Videos
Bisexual
27262 Bisexual Tube Videos
Outdoor
75546 Outdoor Tube Videos
Party
69963 Party Tube Videos
Chubby
23754 Chubby Tube Videos
Sex
523508 Sex Tube Videos
Student
48349 Student Tube Videos
British
18452 British Tube Videos
Cum
204560 Cum Tube Videos
African
11879 African Tube Videos
Spy
10666 Spy Tube Videos
Group Sex
248915 Group Sex Tube Videos
Big Cock
242558 Big Cock Tube Videos
Nudist
18188 Nudist Tube Videos
Prostitute
14264 Prostitute Tube Videos
3d
6432 3d Tube Videos
Doggystyle
112607 Doggystyle Tube Videos
Tranny
73665 Tranny Tube Videos
Fisting
20928 Fisting Tube Videos
Flasher
28011 Flasher Tube Videos
Ebony
186967 Ebony Tube Videos
Lesbian Teen
46858 Lesbian Teen Tube Videos
Brazilian
13964 Brazilian Tube Videos
Anime
11020 Anime Tube Videos
Filipina
1908 Filipina Tube Videos
Blowjob
1005164 Blowjob Tube Videos
Insertion
9423 Insertion Tube Videos
Ugly
1143 Ugly Tube Videos
Egyptian
550 Egyptian Tube Videos
Jerking
40053 Jerking Tube Videos
Mature Lesbian
37444 Mature Lesbian Tube Videos
Chinese
8681 Chinese Tube Videos
DPed Anal
6490 DPed Anal Tube Videos
Exhibitionists
1993 Exhibitionists Tube Videos
Hermaphrodite
135 Hermaphrodite Tube Videos
Pornstar
120207 Pornstar Tube Videos
Stockings
64012 Stockings Tube Videos
Big Black Cock
41647 Big Black Cock Tube Videos
Deepthroat
40575 Deepthroat Tube Videos
Cum Swallowing
19908 Cum Swallowing Tube Videos
Missionary
17567 Missionary Tube Videos
Spanked
14575 Spanked Tube Videos
Animation
11004 Animation Tube Videos
Submissive
9537 Submissive Tube Videos
Screaming
2333 Screaming Tube Videos
Pakistani
490 Pakistani Tube Videos
Black
159881 Black Tube Videos
Busty
120204 Busty Tube Videos
Orgy
46189 Orgy Tube Videos
Turkish
3607 Turkish Tube Videos
Rocco
1590 Rocco Tube Videos
Twins
1109 Twins Tube Videos
Couple
203678 Couple Tube Videos
Solo
116019 Solo Tube Videos
Nude
83041 Nude Tube Videos
Femdom
36655 Femdom Tube Videos
Panties
28834 Panties Tube Videos
Transsexual
14282 Transsexual Tube Videos
Car
14082 Car Tube Videos
Gloryhole
13147 Gloryhole Tube Videos
Fat Mature
7209 Fat Mature Tube Videos
Fucking
671390 Fucking Tube Videos
Big Tits
372093 Big Tits Tube Videos
Beauty
103023 Beauty Tube Videos
Strap On
57598 Strap On Tube Videos
Squirt
20548 Squirt Tube Videos
Nipples
16438 Nipples Tube Videos
Upskirt
14450 Upskirt Tube Videos
Kitchen
8610 Kitchen Tube Videos
Spanish
3629 Spanish Tube Videos
Saggy Tits
1105 Saggy Tits Tube Videos
Tits
474258 Tits Tube Videos
Pussy
350344 Pussy Tube Videos
Dildo
97111 Dildo Tube Videos
Sperm
37510 Sperm Tube Videos
Small Cock
19077 Small Cock Tube Videos
Anus
14605 Anus Tube Videos
Milk
5803 Milk Tube Videos
Mmf
4975 Mmf Tube Videos
Secretary
4832 Secretary Tube Videos
Mexican
3470 Mexican Tube Videos
Forest
2606 Forest Tube Videos
Behind The Scenes
1538 Behind The Scenes Tube Videos
Nun
665 Nun Tube Videos
Gyno Exam
469 Gyno Exam Tube Videos
Bondage
36715 Bondage Tube Videos
Gorgeous
30021 Gorgeous Tube Videos
Doll
22778 Doll Tube Videos
Anal Creampie
19594 Anal Creampie Tube Videos
Office
15125 Office Tube Videos
Anal Fisting
12550 Anal Fisting Tube Videos
Rimjob
10807 Rimjob Tube Videos
Ffm
10269 Ffm Tube Videos
Double Fucking
8592 Double Fucking Tube Videos
Boss
5803 Boss Tube Videos
Transvestite
5652 Transvestite Tube Videos
Chunky
4594 Chunky Tube Videos
Swedish
2690 Swedish Tube Videos
Golden Shower
2445 Golden Shower Tube Videos
Interview
2347 Interview Tube Videos
Prostate
1103 Prostate Tube Videos
Greek
599 Greek Tube Videos
Big Ass
109995 Big Ass Tube Videos
Latina
95183 Latina Tube Videos
Lingerie
64178 Lingerie Tube Videos
Cfnm
22943 Cfnm Tube Videos
Pantyhose
17298 Pantyhose Tube Videos
Crossdressing
7865 Crossdressing Tube Videos
Classroom
2803 Classroom Tube Videos
Enema
614 Enema Tube Videos
Alien
241 Alien Tube Videos
Pages: 1 2 3 4 5 ... 12218
Today top searches
Search
. 50plus
. Abused young
. Amateur teen orgasm
. Asian bbw uncensored
. Asian torture
. Bbw wife
. Blonde webcam teen
. Cuckold training
. Daddy creampie
. Doctor wife
. Eating mature pussy
. Fuck my wife
. Gay
. German anal
. Granny skinny
. Hairy mature r20
. Hot wife rio
. Indian aunty
. Indian model
. Indian telugu
. Italian group
. Japanese daughter law
. Japanese lesbian schoolgirl teacher
. Kinky vintage fun
. Lady sonia blowjob
. Lesbian asslick
. Lesbian nipple clamps
. Mature amateur cuckold
. Mature hairy dildo
. Mature hidden
. Mom drunk
. Mom stepson
. Niece
. Outdoor bdsm
. Real mom son
. Solo teen posing nude
. Ukrainian teen
. Upskirt mom
. Vintage nudist
. Young daughter destruction
Free porn videos
Hot Pornstars Fucking
Search
A
B
C
D
E
F
G
H
I
J
K
L
M
N
O
P
Q
R
S
T
U
V
W
X
Y
Z
. Adriana Voggel
. Angelina Hart
. Audrey Argento
. Bella Moretti
. Brian Surewood
. Cassey Lyn
. Chris Porter
. Eduarda
. Fern
. Gaya Patal
. Ginger Jolie
. Giselle Monet
. Hanna Montada
. Jennifer Best
. Jessica Drake Asa Akira
. Jessica Swan
. Kristal
. Laura Gemser
. Makita
. Mari Sasaki
. Mary Lee
. Melanie Petite
. Melodie
. Milan Sterling
. Morgana Dark
. Nelly Sulivan
. Sabrina Moore
. Sadie West
. Sara Luvv
. Sierra Nevadah
. Sophia Castello
. Vanessa Lane
. Vanilla Deville
. Victoria Valentina
. Violet Monroe
Top List of Porn Tube Sites
1-40
01Movie Mo
02Video One
03Porno Rama
04Hot Sex Tube
0521 Pornhub
06Paris Tube Porn
07Matures Naked
08Sex Tube Films
09Sex Tube Club
10Nice Sex Tube
11Porn Setup
12Hairy Tube
13DT Video
14Pipe Porn Tube
15Car Tube Video
16Dwarfs Tube
17Free Porn Tube
18Spy Videos Tubes
19Porn Tube Boobs
20Voyeur Sex Films
21New Sex TV
22Sfico
23Xxx Tube Movies
24KeX Tube
25Anal Sex Tube
26Hardsextube Porn
27Video You Tube
28Mag Post
29Place of Porn
30My Retro Tube
31XNXX Movies
32Moms Xxx Movies/
33Pink Dino
34Crunk Movies
35Rulertube
36Home Private Vids
37Free Milf Videos
38Filth Matures
39Free Xxx Tube
40Xxx Sex Anal
41-80
41Dads Sex Videos
42Hard Porn
43Perfect Sex Movies
44Sex Tube Videos
45Hot Milf Clips
46Pornesto
47Matures Fuck Tube
48Cute Porn TV
49Mature Videos Porn
50Best Sex Tube
51Devils Gals
52Dildo Xxx Tube
53Oral Sex Movies
54Free Sex Tube
55Lucky Porno Tube
56Kinky Gonzo Porn
57Free Tube Porno
58Sex Tube Fuck
59Stolen Wifes
60Xhamster Porn
61Boss Video
62Sexy Sluts
63Hot Fuck Films
64Xxx Matures Tube
65Extreme Fetish Videos
66Jizz Tube Porn
67Hard Homemade Porn
68Pornhub
69Sexy Porn Clips
70Free Porno
71Best Xxx Fuck
72Wife Porno Movies
73Mom Tube Sex
74Porn Tube Archive
75Fat Fuck Tube
76Free Iphone Porn
77Beeg Porn Tube
78World Porn Movies
79Free Xxx Movies
80Mature Anal Sex
81-120
81Homemade Videos
82Free Amateur Porn
83Plumper Xxx Videos
84Fuck Videos
85Hq Sex Tubes
86Free Moms Sex
87Free Fuck Mom
88Porn Sun Shine
89Beeg Tube
90Older Mom Tube
91XiX Porn Tube
92Mommy Sex Movies
93Stream Sex
94Slutty Daddy
95Kaza Porn Tube
96QoQ Tube
97Goblins Tube
98AzA Porn Tube
99Porn Control
100Xxx Sex Fuck
101Fuck Anal Tube
102Free Sex Tube
103Mr Porn
104Anal Xxx Tube
105Movs Porn Tube
106Xhamster
107Porno Videos
108Wow Fuck Tube
109U Xxx Tube
110All Fuck Tube
111Mature Free Porn
112Real Asian Porn
113Public Porn Clips
114Funny Moms Tube
115Squirting Porno
116XaX Tube
117My Xxx Movies
118Xhamster Movies
119Hq Sex Video
120Xxx Hd Videos
121-160
121Hidden Cam Porn
122Free Mommy Porn
123Naked Boobs Porn
124Boobs Xxx Porn
125Perky Wives
126La Xxx Porn
127Warm Pussy Tube
128Sexy Hairy Women
129Incredible Asian Sex
130KoK Porn Tube
131Mrs Sex Tube
132Porn Hub Com
133Live Granny
134Matures Nude Tube
135Mommy Porn Videos
136Xxx Online Porn
137Fuck Porn Xxx
138Free Fuck Porn
139Free Mature Pornstar
140Korean Xxx Movies
141Hard Porn
142Fuck Cam Videos
143Hot Free Xxx
144Mom Sex Tubes
145Korean Porn Tube
146Granny Sex Movs
147Sweet Girls Tube
148Hq Black Porn
149Moms Xxx Porn
150Best Porn Tube
151Sexy Tuber Fuck
152Moms Fuck
153Mommy Porno Videos
154Vintage Porn Videos
155Joker Sex Tube
156Bbw Fuck Videos
157May Be Porn
158Suck Porn Tube
159Cum Comes
160Try Free Porn
161-200
161Top Fuck Tube
162Anal Sex Tube
163World Xxx Tube
164Fuck Tube Movies
165White Porn Tube
166Brown Xxx Tube
167Redtube Porn
168Mature Nude Porn
169Boobs Sex Videos
170Free Porn Tubes
171Youporn.com
172Xvideos Sex
173Free Gonzo
174Flamingo Tube
175Cash Video Tube
176Hot Homemade Tube
177Honey Porn Tube
178Tapir Porn Tube
179Fucking Tube Xxx
180Diamond Tubes
181Granny Xxx Films
182Free Sex Videos
183Gonzo Movies
184Free Anal Tube
185Xxx Fuck Porn
186Latina Fuck Tube
187Granny Porn Videos
188Hardsextube
189Naked Wife Porn
190Xvideos Porn
191Dino Tube
192Wife Porn Tube
193Ice Porn
194Hd Porn
195
196
197
198
199
200
We do not own, produce or host the Teen videos displayed on this website.
All of the Teen videos displayed here are hosted by websites that are not under our control
Abuse - Free Porn

Updated Time

Updating   
Friend links: ProxyFire    More...
Site Map 1 2 3 4 5 6 7 8 9 10 20 30 40 50 60 70 80 90 100 110 120 130 140 150 160 170 180 190 200 250 300 350 400 450 500 550 600 610 620 630 640 650 660 670 680 690 700 710 720 730 740 750
TOS | Contact us
© 2009 MyIP.cn Dev by MYIP Elapsed:36.927ms