INSERT INTO sites(host) VALUES('absolutemed.com') 1045: Access denied for user 'www-data'@'localhost' (using password: NO) absolutemed.com Estimated Worth $389,082 - MYIP.NET Website Information
Welcome to MyIP.net!
 Set MYIP as homepage      

  
           

Web Page Information

Title:
Meta Description:
Meta Keywords:
sponsored links:
Links:
Images:
Age:
sponsored links:

Traffic and Estimation

Traffic:
Estimation:

Website Ranks

Alexa Rank:
Google Page Rank:
Sogou Rank:
Baidu Cache:

Search Engine Indexed

Search EngineIndexedLinks
 Google:
 Bing:
 Yahoo!:
 Baidu:
 Sogou:
 Youdao:
 Soso:

Server Data

Web Server:
IP address:    
Location:

Registry information

Registrant:
Email:
ICANN Registrar:
Created:
Updated:
Expires:
Status:
Name Server:
Whois Server:

Alexa Rank and trends

Traffic: Today One Week Avg. Three Mon. Avg.
Rank:
PV:
Unique IP:

More ranks in the world

Users from these countries/regions

Where people go on this site

Alexa Charts

Alexa Reach and Rank

Whois data

Who is absolutemed.com at whois.godaddy.com

Domain Name: ABSOLUTEMED.COM

Registrar URL:
http://www.godaddy.com

Registrant Name: Ashley Herschman

Registrant Organization: Absolute Med

Name Server:
ns57.domaincontrol.com

Name Server:
ns58.domaincontrol.com

DNSSEC: unsigned



For complete domain details go to:


http://who.godaddy.com/whoischeck.aspx?domain=ABSOLUTEMED.COM



The data contained in GoDaddy.com, LLC's WhoIs database,

while believed by the company to be reliable, is provided "as is"

with no guarantee or warranties regarding its accuracy. This

information is provided for the sole purpose of assisting you

in obtaining information about domain name registration records.

Any use of this data for any other purpose is expressly forbidden without the prior written

permission of GoDaddy.com, LLC. By submitting an inquiry,

you agree to these terms of usage and limitations of warranty. In particular,

you agree not to use this data to allow, enable, or otherwise make possible,

dissemination or collection of this data, in part or in its entirety, for any

purpose, such as the transmission of unsolicited advertising and

and solicitations of any kind, including spam. You further agree

not to use this data to enable high volume, automated or robotic electronic

processes designed to collect or compile this data for any purpose,

including mining this data for your own personal or commercial purposes.



Please note:
the registrant of the domain name is specified

in the "registrant" section. In most cases, GoDaddy.com, LLC

is not the registrant of domain names listed in this database.

Front Page Thumbnail

sponsored links:

Front Page Loading Time

Keyword Hits (Biger,better)

Other TLDs of absolutemed

TLDs Created Expires Registered
.com
.net
.org
.cn
.com.cn
.asia
.mobi

Similar Websites

More...
Alexa鏍囬

Search Engine Spider Emulation

Title:Absolute Medical Equipment - The leader in pre-owned and reconditioned medical equipment since 2001
Description:Absolute Medical Equipment provides the best in refurbished, reconditioned and used equipment for the full range of medical environments
Keywords:Absolute Medical Equipment, refurbished medical equipment, hospital medical equipment, medical equipment, refurbished apparatus, hospital apparatus refurbished devices
Body:
Absolute Medical Equipment - The leader in pre-owned and reconditioned medical equipment since 2001
http://www.absolutemed.com/
: 0 item(s)
Login / Register
Custom Quote
Worldwide SHIPPING
Toggle navigation
Questions? Orders? 1-888-267-2966
Mon - Thurs: 9AM - 7PM (EST) | Fri: 9AM - 5PM (EST)
The leader in pre-owned
and reconditioned
medical equipment since 2001
Questions? Orders? 1-888-267-2966
Mon - Thurs: 9AM - 7PM (EST) | Fri: 9AM - 5PM (EST)
Advanced Search
Medical Equipment
Used Medical Equipment
Hospital Medical Equipment
Medical Clinics Equipment
Doctors Offices Equipment
New Medical Equipment
Certified Pre-Owned
Defibrillator
Automated External Defibrillators (AED)
Lifepak 12
Ultrasound Probes
Hot Deals
New Equipment
Refurbishing Medical Equipment
Company
About Us
News Events
Industries We Serve
Blog
Testimonials
Questions Answers
Contact Us
Browse Our Catalog
Medical Equipment
3D / 4D Ultrasound Machines
Ultrasound Machines
Portable Ultrasound Machines
Ultrasound Probes Transducers
Sonosite Ultrasound Transducers
Siemens Ultrasound Transducers
Acuson Ultrasound Probes
Philips Ultrasound Transducer Probes
ATL Ultrasound Transducer Probes
GE Ultrasound Probes
HP Ultrasound Transducer Probes
Anesthesia Monitors
Autoclaves / Sterilizers
Blood Culture Analyzers
Blood Pressure Monitors
Bone Densitometers
Capnography
Defibrillator
AEDs
Lifepak 12
Dental Equipment
Echocardiography
EKG / ECG Machines
Fetal Monitors
Incubators / Isolettes
Infusion Pumps
Miscellaneous
Patient Vital Signs Monitors
Pulse Oximeters
Spirometers
Stress Test EKG
Colonoscopes
Medical Equipment Parts
New Medical Equipment
Medical Equipment Sale
Hospital Equipment
Ultrasound Probes
Bestsellers
Find More Great Deals
Subscribe to our email newsletter and get the latest news and deals!
Special Offers
Buy Patient Monitor or Anesthesia Monitors Get Defibrillator for FREE
Contact Us is For Free Quote
GE Dash 5000 Patient Monitor
With the family of Dash monitors from GE Healthcare, you have allthe flexibility you need in a single, portable platform.
More Info
SALE! Datex Ohmeda Compact AS/5 Patient Monitor
A complete monitor for anesthesia, the Datex-Ohmeda AS/5 anesthesia monitor is a multi-parameter monitor.
More Info
GE Vivid e Portable Ultrasound Machine
Remarkable. Portable. Affordable.
More Info
Previous
Next
Low Price Guaranteed
Dedicated Customer Service
Fast Quote Turn Around
UNITS LISTED ARE RECONDITIONED UNITS.
NEW UNITS ARE ALSO AVAILABLE,
PLEASE CALL 1-845-738-4283
FOR DETAILS.
Buying used medical equipment can save you more than 50% over buying new!
Buy Medical Equipment
Ultrasound Equipment
Patient Monitors
Portable Ultrasound
Ultrasound Probes
ECG / EKG Machine
Fetal Monitors
New Equipment
Ask Equipment Expert
Featured Products
Datascope Passport(II) 2 Patient Monitor
Request A Free Quote
GE Corometrics 129 Fetal Monitor
Request A Free Quote
GE Marquette MAC 5000 Premium Resting ECG EKg
Our Price: $1295.00
Compare Price: $4500.00
Save: $3205.00
Lifepak 12 Defibrillator - Biphasic, 12-Lead, AED, Pacing
Request A Free Quote
Hospital Medical Equipment
Looking to buy an EKG Machine? We carry a large selection of portable and cart mounted EKG Machines. In the market for an Ultrasound Machine? We carry one of largest selection of portable ultrasound machines, ultrasound equipment, portable ultrasound and ultrasound probes in the New York City area. Need a pulse oximeter? We carry a large selection of pulse oximetersWe also carry bone density machines, including DEXA, DXA and ultrasound models. We carry full body, heel and hand bone densitometers. including Nellcor OxiMax and Masimo SET SpO2 sensors. Make sure to sure to check out our huge selection of fontfontLifepak 12 defribrillators
Medical equipment is a necessary part of any medical practice. Whether it is new or used, medical equipment must meet the needs of those who will be using the equipment, function reliably and be easy to maintain.
Our Top Customers
Used Medical Equipment
Medical Equipment is expensive, for this reason, used equipment may be a realistic option for many practices.
Purchasing used medical equipment does not necessarily mean buying inferior equipment. Many pieces of used equipment are gently used and will enjoy a long life with a new buyer. Many practices just starting out choose to buy used medical equipment, replacing older equipment with newer models when funding becomes available. This used equipment is often in top operating condition and can be sold at a reduced cost to others looking for used equipment.
Absolute Medical has been rated by its peers in the industry as one of the top 100 medical companies conducting business on DOTmed.com
Products
Patient Monitors
Defibrilator
ECG / EKG Machines
Pulse Oximeters
Bone Densitometers
Ultrasound Equipment
Ultrasound Transducers
Fetal Monitors
Blood Pressure Monitors
Dental Equipment
Blood Analyzers
Stress Test EKGs
Medical Equipment News
Company Info
About Us
Contact Us
Shipping Information
Privacy Policy
FAA Approved ECG Machines
Used Medical Equipment
Terms amp; Conditions
Donate Medical Equipment
Questions Answers
Site Map
Contact Us
380 Gate Hill Road, Stony Point, NY 10980
Tel: 1-888-267-2966
| (845) 738-4283
Fax: 845-517-0044 | Email: sales@absolutemed.com
Follow us
copy; 2016 Absolute Medical Services, Inc.. All rights reserved.
Powered by Adrecom's e-commerce suite
times;
Ask Equipment Expert
Value entered for e-mail is invalid
Passwords don't match
Please fill up missing fields below
First Name*
Last Name*
E-mail*
Phone Number
Question
Close
FORM
times;
Need a Custom Quote?
Value entered for e-mail is invalid
Passwords don't match
Please fill up missing fields below
Full Name: *
Company:
E-mail: *
Phone Number:
Comments or Questions:
Close
times;
Login Into Your Account
Value entered for e-mail is invalid
Passwords don't match
Please fill up missing fields below
You've entered wrong login (e-mail) or password. Please try again
Your account is not yet activated or disabled.
Login or password can not be empty
A reset password e-mail has been sent to the provided address
E-mail:*
Password:*
Log me in automatically next time
Forgot your password?
Value entered for e-mail is invalid
Email can not be blank
Account with that email address does not exist at this portal. Please try again.
Account with that email address does not exist. Please try again.
Service temporary unavailable.
E-mail:*
Login into your account
Close
Login to Account
Recover password
times;
Request A Free Quote
Value entered for e-mail is invalid
Passwords don't match
Please fill up missing fields below
First Name*
Last Name*
E-mail*
Day Time Phone
Cell Phone
Fax
Ship to Country*
UNITED STATESAFGHANISTANA'LAND ISLANDSALBANIAALGERIAAMERICAN SAMOAANDORRAANGOLAANGUILLAANTARCTICAANTIGUA AND BARBUDAARGENTINAARMENIAARUBAAUSTRALIAAUSTRIAAZERBAIJANBAHAMASBAHRAINBANGLADESHBARBADOSBELARUSBELGIUMBELIZEBENINBERMUDABHUTANBOLIVIABOSNIA AND HERZEGOVINABOTSWANABOUVET ISLANDBRAZILBRITISH INDIAN OCEAN TERRITORYBRUNEI DARUSSALAMBULGARIABURKINA FASOBURUNDICAMBODIACAMEROONCANADACAPE VERDECAYMAN ISLANDSCENTRAL AFRICAN REPUBLICCHADCHILECHINACHRISTMAS ISLANDCOCOS (KEELING) ISLANDSCOLOMBIACOMOROSCONGOCONGO, THE DEMOCRATIC REPUBLIC OF THECOOK ISLANDSCOSTA RICACOTE D'IVOIRECROATIACUBACYPRUSCZECH REPUBLICDENMARKDJIBOUTIDOMINICADOMINICAN REPUBLICECUADOREGYPTEL SALVADOREQUATORIAL GUINEAERITREAESTONIAETHIOPIAFALKLAND ISLANDS (MALVINAS)FAROE ISLANDSFIJIFINLANDFRANCEFRENCH GUIANAFRENCH POLYNESIAFRENCH SOUTHERN TERRITORIESGABONGAMBIAGEORGIAGERMANYGHANAGIBRALTARGREECEGREENLANDGRENADAGUADELOUPEGUAMGUATEMALAGUINEAGUINEA-BISSAUGUYANAHAITIHEARD ISLAND AND MCDONALD ISLANDSHOLY SEE (VATICAN CITY STATE)HONDURASHONG KONGHUNGARYICELANDINDIAINDONESIAIRAN, ISLAMIC REPUBLIC OFIRAQIRELANDISRAELITALYJAMAICAJAPANJORDANKAZAKHSTANKENYAKIRIBATIKOREA, DEMOCRATIC PEOPLE'S REPUBLIC OFKOREA, REPUBLIC OFKUWAITKYRGYZSTANLAO PEOPLE'S DEMOCRATIC REPUBLICLATVIALEBANONLESOTHOLIBERIALIBYAN ARAB JAMAHIRIYALIECHTENSTEINLITHUANIALUXEMBOURGMACAOMACEDONIA, THE FORMER YUGOSLAV REPUBLIC OFMADAGASCARMALAWIMALAYSIAMALDIVESMALIMALTAMARSHALL ISLANDSMARTINIQUEMAURITANIAMAURITIUSMAYOTTEMEXICOMICRONESIA, FEDERATED STATES OFMOLDOVA, REPUBLIC OFMONACOMONGOLIAMONTSERRATMOROCCOMOZAMBIQUEMYANMARNAMIBIANAURUNEPALNETHERLANDSNETHERLANDS ANTILLESNEW CALEDONIANEW ZEALANDNICARAGUANIGERNIGERIANIUENORFOLK ISLANDNORTHERN MARIANA ISLANDSNORWAYOMANPAKISTANPALAUPALESTINIAN TERRITORY, OCCUPIEDPANAMAPAPUA NEW GUINEAPARAGUAYPERUPHILIPPINESPITCAIRNPOLANDPORTUGALPUERTO RICOQATARREUNIONROMANIARUSSIAN FEDERATIONRWANDASAINT HELENASAINT KITTS AND NEVISSAINT LUCIASAINT PIERRE AND MIQUELONSAINT VINCENT AND THE GRENADINESSAMOASAN MARINOSAO TOME AND PRINCIPESAUDI ARABIASENEGALSERBIA AND MONTENEGROSEYCHELLESSIERRA LEONESINGAPORESLOVAKIASLOVENIASOLOMON ISLANDSSOMALIASOUTH AFRICASOUTH GEORGIA AND THE SOUTH SANDWICH ISLANDSSPAINSRI LANKASUDANSURINAMESVALBARD AND JAN MAYENSWAZILANDSWEDENSWITZERLANDSYRIAN ARAB REPUBLICTAIWAN, PROVINCE OF CHINATAJIKISTANTANZANIA, UNITED REPUBLIC OFTHAILANDTIMOR-LESTETOGOTOKELAUTONGATRINIDAD AND TOBAGOTUNISIATURKEYTURKMENISTANTURKS AND CAICOS ISLANDSTUVALUUGANDAUKRAINEUNITED ARAB EMIRATESUnited Kingdom (Great Britain)UNITED STATES MINOR OUTLYING ISLANDSURUGUAYUZBEKISTANVANUATUVENEZUELAVIET NAMVIRGIN ISLANDS, BRITISHVIRGIN ISLANDS, U.S.WALLIS AND FUTUNAWESTERN SAHARAYEMENZAMBIAZIMBABWE
System you are interested in
Budget
(Please check all that apply)
Vascular
Cardiac
Obstetrics
Gynecological
Transvaginal
Abdominal
Shared Service
DICOM
Color Doppler
PW Doppler
CW Doppler
Tissue Harmonics
3D/4D
Transrectal
Transesophogeal (TEE)
Networking
Portable
Wheeled/Fixed
Comments
Close
FORM

Updated Time

Updating   
Friend links: ProxyFire    More...
Site Map 1 2 3 4 5 6 7 8 9 10 20 30 40 50 60 70 80 90 100 110 120 130 140 150 160 170 180 190 200 250 300 350 400 450 500 550 600 610 620 630 640 650 660 670 680 690 700 710 720 730 740 750
TOS | Contact us
© 2009 MyIP.cn Dev by MYIP Elapsed:80.848ms